KEGG   Gluconobacter oxydans H24: B932_1979Help
Entry
B932_1979         CDS       T02348                                 

Definition
glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
goh  Gluconobacter oxydans H24
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:goh00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    B932_1979
Enzymes [BR:goh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     B932_1979
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2001568..2002236
Genome map
AA seq 222 aa AA seqDB search
MRILHHLPLSPQCRLVRLVLGEKRLPCELVIERVWEQREEFLALNPAGEVPVLVEENGLA
VPGARVICEYLDEAYPDTPLLGRTLAERVEVRRLMDWFESRFAQEVTRNLLGEKVDKRLY
GRGHPDGNVLRAGYGNMRFHLDYIGWLAETRSWLAGPSISMADFAAAAQLSALDFIGDVN
WAKAPAAKDWYARVKSRPCFRGLLTDRMSGITPPGHYANLDF
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcctgcatcaccttccactctccccgcaatgccgtctggttcggcttgtgctc
ggcgagaagagactgccctgcgaactcgtgatcgaacgggtctgggaacagcgtgaggaa
ttccttgcgctgaaccccgctggcgaagttcccgtccttgttgaagagaacgggcttgcc
gttcccggcgcccgggttatctgcgaatatctggacgaagcttacccggatacccctctg
ttagggcgtacgctggctgagcgcgttgaggttcgccgcctgatggactggttcgaaagc
cggtttgctcaggaagtcacacgtaatcttctgggtgagaaggtggacaagcgtttgtat
ggtcgtggtcatccggacggtaatgtgctgcgggctggctatggcaacatgcggttccac
ctggattatatcggctggcttgcggagacgcggtcctggctggcgggcccatccatttcg
atggccgatttcgcggcggcagcgcagctctctgcgcttgacttcattggggacgtgaac
tgggccaaggcacctgctgccaaagactggtatgcccgggtcaaatcccgcccatgtttc
cgtggacttctgacggaccggatgagtggcattacgcctcccggtcattacgctaatctg
gatttctga

DBGET integrated database retrieval system