KEGG   Gluconobacter oxydans H24: B932_2072Help
Entry
B932_2072         CDS       T02348                                 

Definition
NAD-dependent alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
goh  Gluconobacter oxydans H24
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:goh00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    B932_2072
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B932_2072
  Lipid metabolism
   00071 Fatty acid degradation
    B932_2072
  Amino acid metabolism
   00350 Tyrosine metabolism
    B932_2072
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    B932_2072
   00626 Naphthalene degradation
    B932_2072
Enzymes [BR:goh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     B932_2072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2089055..2090083)
Genome map
AA seq 342 aa AA seqDB search
MADTMLAAVVREFGKPLSVERLPIPEIRPNQILVKVDTCGVCHTDLHAAEGDWPAKPNPP
FIPGHEGIGHIVAVGSQVNHVKVGDVVGVPWLYSACGHCEHCLGGWETLCKDQDDTGYTV
NGCFAEYVVADPNYVAHLPSNIDPLQAAPVLCAGLTVYKGLKMTEARPGQWMAISGVGGL
GQMAVQYAVAMGMNVVAVDIDDDKLATAKKLGAALTVNAKDKDPAAFIQQEVGGAHGALV
TAVGRTAFSQAMGYARRGGTIVLNGLPPGDFPVSIFDMVMNGTTIRGSIVGTRLDMIEAM
DFFARGKVKSVVTADKIENINTIFDNLKNGRLQGRTVLDFRS
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggctgatacaatgctggccgccgtcgtccgcgagttcgggaagcctctctccgttgag
aggcttcccatccccgagatccggcctaaccagatcctcgtgaaagtggatacctgcggc
gtctgccataccgacctgcacgccgcagaaggggattggcctgcaaagccgaacccgccg
ttcatcccgggccatgaaggcatcggtcacatcgtggccgttggcagtcaggtcaatcac
gtcaaggttggcgacgtagttggcgtgccctggctctactcggcctgcgggcactgcgaa
cactgcctcggtggctgggagacgctgtgcaaggatcaggacgacaccggctacacggtc
aatggctgcttcgccgaatatgtcgtcgcagacccgaactatgtcgcacatctgcccagc
aacattgatccgcttcaggctgccccagtcctttgcgctggcctgaccgtctacaagggc
ctgaaaatgaccgaggcacgccctggtcagtggatggctatttcaggcgttggcggtctg
ggtcagatggctgtgcaatacgccgtcgccatgggcatgaatgtcgtggctgtggatatt
gacgacgacaagcttgccacagcaaaaaagcttggcgccgccctgaccgtcaatgccaag
gacaaggacccggcagccttcatccagcaggaagtcggcggcgctcatggtgctcttgtt
acggccgtgggccgcaccgcattctcgcaggccatgggctatgcccgccggggcggcaca
atcgttctgaacggcctgccaccaggagacttcccggtttcgatcttcgacatggtcatg
aacggcacaaccattcgtggctccatcgtcggcacacggctggacatgatcgaagccatg
gatttcttcgcccgtggcaaagtgaaatccgtcgtcaccgcagacaagatcgagaacatc
aacacgatcttcgacaacctcaaaaacgggcgccttcagggccgtacggttctggatttc
cggtcctga

DBGET integrated database retrieval system