KEGG   Gluconobacter oxydans H24: B932_2330Help
Entry
B932_2330         CDS       T02348                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
goh  Gluconobacter oxydans H24
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:goh00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:goh00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2331717..2333168)
Genome map
AA seq 483 aa AA seqDB search
MRLSELLRQNGSVLSPSVDPEILTVTADSRQVRPGTLFFALRGAKQDGAAFIPQAVTNGA
VAIIADHPAEADVPVLLTPDAKHLLALMAATLAGPQPSCIAAVTGTNGKSSTAEFLRQLW
MLQGLKAASLGTLGLITNVDVPPPPSLTTPDPVSLAATLASLAQHGVNHVALEASSHGLE
QHRLDGFTLNAAGFSNLTRDHLDYHGTIAAYRAAKLRLFEDLLPANGIAAVNADMDPDTL
NALHAIAAQRGMALRTTGKTGSTLRLLETRPTPTGQIIRLSLYGEDLPEMTLGLPGLFQA
DNAMLAAAMCWQTEDDARSLVDLLPQLTGVRGRCERAAELSNGAAAYVDYAHTPDALERV
LASLRPHTEGRLVVVFGAGGDRDRGKRPLMGEVAARMADVAIVTDDNPRTEEPQSIRAAI
HAACPEALEIGDRRAAIAAGLEALKPGDILVVAGKGHEQGQIVGQTVLPFDDRSVIRELA
GAA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctctctgaacttctccggcagaatggttccgttctgtcgccttccgtcgaccct
gaaattctgactgtgacagcagacagcagacaggttcgaccaggcacactgtttttcgcc
ctgcgaggtgcgaaacaggacggagcagcttttattcctcaggctgttacaaatggtgcc
gtggccatcatcgcggatcatcccgctgaagcagacgtcccggttctgctgacgccagat
gccaagcatctgcttgcactgatggcagcaacgcttgcaggacctcaaccatcctgcatc
gcggccgtaaccggaacaaacggcaaaagcagcacggctgagtttctgcgtcagctctgg
atgcttcagggtctcaaggctgccagccttggaacgctggggctgattacaaatgtcgat
gtaccgcctccgccctcgcttacaacgcctgatcctgtgtcactggcagccacgctggcg
tctctggcgcaacacggtgtgaaccatgtggcgcttgaagcctcttctcacggtctggaa
cagcatcggctggacggctttacgctcaatgctgctgggttttcgaacctgacccgggac
catctggattatcacggcaccattgcagcctatcgggcagcgaaactgcgtctgttcgaa
gatctcctgcctgccaatggtattgccgccgtcaatgcggacatggacccggatacgttg
aacgcactgcacgccattgcagcgcaacggggcatggcacttcggacaacaggcaaaacg
ggaagtacactgcgccttctggagacacgccccacaccgacgggccagattatccgtctc
tctctctatggcgaagatttaccggaaatgacgcttggtttgccgggactgttccaggct
gacaatgccatgctggctgcggcgatgtgctggcagacagaagacgacgcacgcagtctc
gtggatttgctgccgcagttgactggagtacgaggacgctgcgaacgggccgctgaactc
tccaatggcgccgcagcgtatgtcgattatgcgcacacacctgatgcgctggaacgcgtt
ctggcgagccttcgaccacataccgaagggcgtctggtcgtggtctttggtgctggcggc
gatcgtgatcgcggcaagcggccgcttatgggcgaagttgcggcccgcatggccgatgtg
gccattgttacggacgacaacccccgcacggaagaaccgcagagcattcgcgccgccatt
cacgccgcctgccctgaagcactggaaatcggtgatcgtcgggctgccattgcagccggt
ctggaggcgctgaagcccggtgatattctggtcgtcgcgggcaaaggccatgagcagggg
cagattgttggccagacagttcttccatttgatgatcgcagcgtgatccgtgaactggca
ggtgccgcatga

DBGET integrated database retrieval system