KEGG   Gluconobacter oxydans H24: B932_2340Help
Entry
B932_2340         CDS       T02348                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
goh  Gluconobacter oxydans H24
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:goh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    B932_2340
  Amino acid metabolism
   00330 Arginine and proline metabolism
    B932_2340
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    B932_2340
Enzymes [BR:goh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     B932_2340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2342379..2343515)
Genome map
AA seq 378 aa AA seqDB search
MTSPATAPHLAQLRRIVIKIGSALLVDSAQATLRTDWLRSVCEDIANLRKAGTEVVVVSS
GAISLARHQLSLMNRRLRLDEKQALATVGQIGLAQGWSTALAEHGLVAGQLLLTPDDTES
RERHLNARATLQTLIDLGCIPVINENDAIATSEIRFGDNDRLGARVAQMIEADCLVLLSD
IDGLYTADPRTNPDARHIPVIEQVTDEIMAMGGEPPPGYSSGGMRTKLMAARIANRAGAA
MVIAAGQTQNPLQRLLDGGLCTWFLPQTDTGSARKRWIGSSLHPKGALIVDNGARQALIV
GASLLPAGVTAIDGYFERGDLVLIKDENGNTIGRGLPSYNADECRKLIGHRSAEMEQLLG
YRGRDVLIHRDDLALDQH
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgacatccccggccactgcccctcacctggcgcagttgcgccggattgtcatcaagatt
ggtagcgctcttctggttgatagcgcacaggcgacgctgcggacggactggctccgcagc
gtttgtgaagacatcgccaatctgcggaaagcagggacagaagttgtcgttgtttcatcg
ggagcgatctcgcttgcccggcatcagctcagcctgatgaaccgccgacttcggcttgac
gaaaaacaggctctggccaccgttgggcagatcggtctggctcagggatggagcaccgca
ctggccgagcatggactcgttgccggacaacttcttctcacaccggatgataccgaaagc
cgtgaacggcatctcaatgcccgcgccacccttcagacgctgattgatcttggatgcatt
cccgtcattaacgaaaatgatgcgattgcgacgtccgaaatccggttcggtgacaatgat
cgccttggcgcccgcgtggcccagatgatcgaggcagactgtctggttcttctttctgat
attgacggcctctataccgcagatccccgcacgaatcccgatgcacgccatattccagtg
attgaacaggtgacggacgagatcatggcgatgggcggcgaacccccgccaggatattca
tccggcggtatgcgcaccaaactcatggcagcgcgcattgccaatcgcgctggtgcggcc
atggtcattgccgcaggtcagacacagaaccctcttcagaggctactggatggcggcctg
tgcacgtggtttcttccccagaccgataccggctcggcgcgtaagcgctggataggcagc
agtctgcaccccaaaggcgcgctcattgttgataacggcgcccgccaggctctcattgtc
ggtgcttccctgttgcccgctggtgtgactgccattgacgggtatttcgagcgtggcgac
ctagtgctcatcaaggatgagaatggcaacacaatcggtcggggactgccgtcctacaac
gctgatgaatgcaggaagctcattggtcatcggtcagcggagatggagcagcttctgggc
tacagaggccgggatgtgttgatccaccgagacgatctggctctggatcaacactga

DBGET integrated database retrieval system