KEGG   Gluconobacter oxydans H24: B932_2481Help
Entry
B932_2481         CDS       T02348                                 

Definition
phosphomannomutase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
goh  Gluconobacter oxydans H24
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:goh00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    B932_2481
   00052 Galactose metabolism
    B932_2481
   00500 Starch and sucrose metabolism
    B932_2481
   00520 Amino sugar and nucleotide sugar metabolism
    B932_2481
Enzymes [BR:goh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     B932_2481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2480954..2481832
Genome map
AA seq 292 aa AA seqDB search
MIKPLKKAVLPVAGLGTRFLPATKAMPKEMLPVVDKPLIQYAIDEAREAGIEEFCLVTGR
GKDSLIDYFDIAYELEATLKERGKKSALEALQQSSVQAGSLVAVRQQEPLGLGHAIWCAR
SFIGDDPFAILLPDDIVKSGRSCVAQLVEAYNQTGGNVVAVTEVPREHTNRYGILDVGAD
DGRLVEVKGLVEKPDPEDAPSNLSIIGRYVLTADVMEHLSKLERGAGNEVQLTDAMAKMI
GHVPFHGLRYEGTRYDCGDKAGFLEAQIAFSIDRPDLGDAVKAFLKKYVDAV
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
gtgatcaagcccctgaagaaagcagttcttcccgttgcaggacttggaacgcggttcctt
ccagcgaccaaggctatgccgaaggaaatgcttcctgtcgttgacaagccccttattcag
tacgctatcgatgaagcgcgtgaagctggcatcgaagaattctgcctcgtcaccggacgt
ggcaaagacagcctgatcgattatttcgatatcgcttatgagcttgaagcaactctgaaa
gagcgtggcaagaagagcgcgcttgaagcccttcagcaaagcagcgtgcaggctggctcc
cttgtagcggttcgtcagcaggagccgctgggccttggtcatgccatctggtgtgcccgg
tccttcatcggcgatgacccgttcgccattcttcttccggatgacatcgtgaagagcggc
cgcagctgcgtcgcccagctcgtcgaggcctacaaccagacgggcggcaacgttgtcgct
gtgacggaagtcccgcgcgaacacaccaaccgttacggcatccttgatgtcggtgctgac
gatggccgtctcgtggaagtcaagggtttggtcgagaagccagaccctgaagatgctcct
tccaacctgtccatcattggtcgctacgtgctgacggccgatgtgatggagcatctttcc
aagctggagcgtggcgctggcaacgaagtgcagctgacagacgccatggccaagatgatc
ggtcatgttccgttccacggtctgcgctatgaaggaacgcgttatgactgcggtgataag
gcgggcttcctcgaggcacagattgctttttcgatcgatcgccccgacctgggtgatgca
gtgaaggcattcctcaagaagtatgtcgacgctgtttaa

DBGET integrated database retrieval system