KEGG   Gluconobacter oxydans H24: B932_2550Help
Entry
B932_2550         CDS       T02348                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
goh  Gluconobacter oxydans H24
Pathway
goh00010  Glycolysis / Gluconeogenesis
goh00052  Galactose metabolism
goh00500  Starch and sucrose metabolism
goh00520  Amino sugar and nucleotide sugar metabolism
goh00521  Streptomycin biosynthesis
goh01100  Metabolic pathways
goh01110  Biosynthesis of secondary metabolites
goh01120  Microbial metabolism in diverse environments
goh01130  Biosynthesis of antibiotics
goh01200  Carbon metabolism
Module
goh_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:goh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B932_2550
   00052 Galactose metabolism
    B932_2550
   00500 Starch and sucrose metabolism
    B932_2550
   00520 Amino sugar and nucleotide sugar metabolism
    B932_2550
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    B932_2550
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    B932_2550
Enzymes [BR:goh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     B932_2550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: AFW02101
UniProt: K7SLC1
Position
complement(2552966..2553934)
Genome map
AA seq 322 aa AA seqDB search
MREIVAVDIGGTHARFAIASIENGKVVELGEAVTLKCAEHASLALAWEAFGRSLDRPMPK
EAGIAVACPVTGEILKMTNNPWIIHPSQLAQRLHLENFVLVNDFGAVAHAVAQVDPSYMQ
HLCGPDIDLPPQGAITIVGPGTGLGAACLLRRGSRYFVMETEGGHLDYPPLDDVEDRILK
ALRQRFRRVSAERIVSGPGLTNLYEVIAEQQGLPITLRDNKTLWQNAIEGSDTIAAAALE
RFCLSLGAISGDLALAHGAKGVVIAGGLGLRLAGILGESGFAERFVAKGRFEAIMSEMPV
KIITHPQPGLFGAAAAYAEAHS
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagggaaattgttgcggtcgacattgggggcacccacgcccgtttcgcgattgcaagc
atcgagaacgggaaggttgttgagctcggagaagccgtcaccctgaaatgcgccgagcac
gccagtcttgctctcgcctgggaagcttttggccgctcccttgaccggccgatgccaaaa
gaagcgggtattgctgtcgcctgtccggtcaccggcgaaatcctgaagatgaccaataat
ccctggatcatccatccgtcccagctggctcagcgcctgcatctggaaaatttcgtgctg
gtcaacgatttcggtgccgtcgcccatgcagtagcgcaggttgacccctcctacatgcag
catctctgcggaccggacattgaccttcctccacagggagcgattacaatcgtgggcccc
ggtacgggcttgggtgccgcatgccttcttcgacgcggatcgaggtatttcgtcatggag
acagaaggcggccatctggactacccaccgctcgatgacgttgaagaccggatcctgaag
gctctgcgtcaacgtttccgccgtgtatcggcagagcggatcgtgtccggaccgggcctg
acgaatctttatgaagtcatcgcggaacagcagggactgcccattaccctgcgtgacaac
aagaccctctggcagaacgcaatagaaggctcggataccatcgccgctgccgccctcgaa
cgattctgcctcagtctcggcgcgatttctggcgacctggctctcgcgcatggcgcaaag
ggcgtcgtcattgcgggcggcctgggcctgcgtctggcaggaattcttggagagtccgga
tttgcagaacgcttcgttgccaaagggcgttttgaggcaataatgagcgaaatgcccgtc
aagatcatcacgcatccgcagccaggactatttggcgcggcggcagcatatgcggaagct
cattcctga

DBGET integrated database retrieval system