KEGG   Gluconobacter oxydans H24: B932_2707Help
Entry
B932_2707         CDS       T02348                                 

Definition
dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
goh  Gluconobacter oxydans H24
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:goh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B932_2707
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B932_2707
   00020 Citrate cycle (TCA cycle)
    B932_2707
   00620 Pyruvate metabolism
    B932_2707
Enzymes [BR:goh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     B932_2707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2705357..2706589)
Genome map
AA seq 410 aa AA seqDB search
MATDILMPALSPTMTEGKLARWLKNEGDTVSAGDVIAEIETDKATMEVEAVDEGILGRIL
VQEGAEGVAVNTPIAILVEEGEEVPVASSGQTSAIAASAAEPVAAASAPAPSAKAASKEE
SSERIFVSPLAKRMAKERGIALGSLNGTGPNGRILKRDVEKGGNAAPAAPKAAPVTPVAV
EGDVKRVPNSTMRKVIARRLTESKTQVPHFYVSVDIELDALLALRSKLNATAEENNFKLS
VNDMMIKAVGLALKKVPGLNVQFTDSETLHFENVDISMAVSIPDGLITPIIRNADQKSLR
EISREAKDLAKRARAGKLKPEEFQGGTFSISNMGMFGVRDFAAIINPPQAGILAIASGEK
RAVVRGDQLAIATVMTATLSVDHRAVDGALGAQWLNALRDIVQNPYTLVV
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgatatcctgatgccggctctgtcgccgacaatgaccgagggcaaactggcc
cgctggctcaaaaatgaaggcgatacagtttcagccggtgatgtgatcgccgaaatcgag
accgacaaggccacaatggaagtcgaagctgtggacgagggcatactcggccgcattctt
gttcaggaaggcgcagaaggcgttgcggttaacacgccaatcgccatccttgtagaggaa
ggcgaagaggtgccagtagcgtcttccgggcagacgtctgctatcgcggcttcggccgct
gagcctgttgctgctgcaagtgcacctgcgccaagcgccaaagccgcctcgaaagaggag
agcagtgagcgtatttttgtctcgccgctggcaaagcgtatggccaaagagcggggcatc
gctcttggctctctgaacggaacaggcccgaatggccgtattctgaaacgggacgttgag
aagggcggtaacgctgctccagccgcaccgaaagctgcacctgtaacgccggttgccgtt
gaaggtgacgtaaagcgcgttccgaattccacgatgcgcaaggtcattgcgcggcgtttg
acggaatcgaagacgcaggttccgcatttctatgtctcagtggacatcgaacttgatgct
ctgctcgcacttcgctcaaagctgaatgcgaccgccgaggagaacaacttcaagctctcg
gtcaatgacatgatgatcaaggctgtcgggctggcactgaaaaaggtaccgggtctgaac
gttcagttcacggattccgagacgctgcatttcgagaatgtggacatctcaatggctgta
tccatcccggatggcctgatcacgccgatcatccggaatgcggaccagaagtccctgcgc
gaaatcagccgtgaagccaaggatctggccaagcgtgcacgtgcgggcaagctgaagccg
gaagaattccagggcggtacgttctccatttcgaatatgggaatgtttggcgtccgggat
tttgccgcgatcatcaatccgccgcaggccggaattctggccattgcgtccggagagaaa
cgtgccgtggttcggggagaccagcttgcaattgcaactgtcatgaccgcgacactttct
gttgatcatcgtgccgttgatggcgcacttggggcacagtggctgaatgccctgcgcgat
atcgtacagaacccttacactctggtggtctga

DBGET integrated database retrieval system