KEGG   Gluconobacter oxydans H24: B932_2807Help
Entry
B932_2807         CDS       T02348                                 

Definition
hypothetical protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
goh  Gluconobacter oxydans H24
Brite
Enzymes [BR:goh01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     B932_2807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2807121..2808020
Genome map
AA seq 299 aa AA seqDB search
MKFSGLSLLLVTLSWLAVPALAACLSPDAAKKELGHRLFYDADLSLDGSMSCATCHEQRH
AFSDGNPTHPGVTDEQGIRNVPSLANVGAFQSLTWIDQHVTSLEKQFFIPLSGHHPVEMG
MTDVAELSRRLSGNSCYHALFATAFPGKASVMDAEHVSQAIAAFERILVSNKALWDQPGH
KETVKQQRGERLFFGKAKCSSCHEPPLFMDQAFHVLSSSQSSPVRTPSLRNVEVTAPYLH
DGSAPTLVAAIQAHPGAGILSRAEIENISAFLRLLTDRTFLSRQDIALPAEQCPVRIMP
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtgaagttctctggcctgtctctattgctggtcacattgagttggctggcagttcctgct
ctcgctgcctgtctgtctccagacgcagcaaagaaagagctaggccatcgtctcttctac
gatgcagacctgtctctggatggcagcatgtcctgcgcaacatgtcacgaacagagacat
gccttttctgacggtaatccaacacatcctggcgtcacggatgaacagggcatccgaaac
gttccgtctctcgccaatgtgggagcgtttcaaagtctgacgtggatagatcagcacgtt
acctctcttgaaaagcagttctttatccctctgagcggtcatcatccggttgaaatgggg
atgaccgatgtggcggaactctcccggcgcctttcagggaattcctgttaccacgcgctt
tttgcaactgcgtttccaggcaaagcgagcgtaatggatgccgagcatgtctctcaggct
atcgcagcgtttgagcgcattttggtgtcgaataaagcactgtgggaccagcctggacac
aaagaaacagtaaagcagcaacgtggtgagagattgttttttggtaaagcgaaatgcagt
tcctgtcatgaacctcccctgttcatggatcaggcctttcacgtgctttccagtagtcag
agcagccccgtcagaacgccgtcccttcgcaatgttgaagttacggctccttatctgcat
gacggatctgcgccgacactcgttgctgccatccaggcgcatccgggtgcaggcatttta
tcgagggcagagatagagaatatttcggcttttctacgacttctgacggatcgtacgttt
ctctcacgtcaggacattgccttgcctgccgaacaatgccctgtcaggattatgccctga

DBGET integrated database retrieval system