KEGG   Gluconobacter oxydans H24: B932_3230Help
Entry
B932_3230         CDS       T02348                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
goh  Gluconobacter oxydans H24
Pathway
goh00220  Arginine biosynthesis
goh00330  Arginine and proline metabolism
goh01100  Metabolic pathways
goh01110  Biosynthesis of secondary metabolites
goh01130  Biosynthesis of antibiotics
goh01230  Biosynthesis of amino acids
Module
goh_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:goh00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    B932_3230
   00330 Arginine and proline metabolism
    B932_3230
Enzymes [BR:goh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     B932_3230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AFW02775
UniProt: K7TDE5
Position
3303390..3304289
Genome map
AA seq 299 aa AA seqDB search
MQLVLAPSNLGLTPLHDGHVPGTWRAPEALMDAGLGKAVNYSHLHSLPRPDYRPEAQKGT
RIRNGHAIRAYDLILGETVGSICKSGELALVIGGDCSLLLGGLVGARQIGPVSLIHIDGH
SDFRHPGNYDPAVLSGAAGMDLALTTGRGEPLLTVWPDVSGPLVSDVNVIQIGEREGYDP
DFAWPDIADTAIEQVDIFEALKVGPPGLSQRIHDVLLRAPEQSFWIHFDVDVMDQVIMPA
VDCPGSPGLSPEYLVQILSPLVSSTRCLGMTLTIYDPDRDSTGRCGTTIIDILRALPFR
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgcaacttgttctcgccccgtcaaaccttggactgactcccctccatgatggtcatgtc
cccggaacatggcgtgcacctgaagcccttatggacgccggcctcgggaaggccgtgaac
tacagtcacctccatagccttccgaggccggactatcgtcctgaggctcagaagggaacg
cgtattcgcaacggacacgccattcgtgcttacgacctcatccttggagaaacggttgga
agtatctgtaagtcaggtgaactcgcgcttgttatcggcggagactgctctctgttgctt
ggaggactggtaggcgctcgacagattggacctgtttcactgatccatatcgacggacac
agcgacttcaggcacccggggaattacgatccagcagtcctcagcggtgcagccggtatg
gatctggcgctcacgaccggacgcggtgaaccgcttctgactgtttggcccgacgtctca
ggtccgctggtttcggatgtgaatgtcattcagattggtgagcgtgagggttacgatccc
gactttgcctggcccgatatcgcagacacggcgattgagcaggttgatatttttgaagcc
ctgaaggtcggtccgccagggctatctcagcgcatccatgatgtgcttcttcgagcccct
gagcaaagcttctggatccatttcgacgtcgatgtcatggatcaggtgatcatgcccgca
gtggattgtccgggttctcctggcctttcacccgaatatctggtccagatcctctctccc
cttgtatccagcacgcgatgcttgggcatgactctgactatttacgatcctgatcgggat
tcgacggggcggtgtggcacgactatcatcgatattcttcgcgcgctcccgtttcgatga

DBGET integrated database retrieval system