KEGG   Gluconobacter oxydans H24: B932_3254Help
Entry
B932_3254         CDS       T02348                                 

Definition
(GenBank) Putative GST-like protein yfcG
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
goh  Gluconobacter oxydans H24
Brite
Enzymes [BR:goh01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     B932_3254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3322121..3322393)
Genome map
AA seq 90 aa AA seqDB search
MPEKIPYAITRYVNETNGLYGVMNRRLAQVPLFGGTDYSLADMANCPWAVPWQRLQQNLE
EFPNLKRWFDTIVARPAAIRAYEKGKDISD
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
gtgccggagaaaattccctacgccatcacacgctatgtcaacgagaccaacgggctgtat
ggtgtcatgaatcggcgtctggcgcaggtgccactcttcggtggcaccgattacagcctt
gcggacatggccaactgtccatgggcagtgccgtggcagcgcctgcagcagaaccttgag
gaatttccaaacctgaagcgctggtttgataccatcgtcgcgcgcccggcagcgatacgg
gcctatgagaaaggcaaggatatctcagactga

DBGET integrated database retrieval system