KEGG   Gluconobacter oxydans H24: B932_3282Help
Entry
B932_3282         CDS       T02348                                 

Definition
Protein gstA
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
goh  Gluconobacter oxydans H24
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:goh00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3345180..3345815
Genome map
AA seq 211 aa AA seqDB search
MSPVLLSPAKGHLLMLLYDLDVSGNCYKIRLFAALTDTKLDLVPVDLAASENHDSDFRKL
NRFGEVPVLVDGDLTLRDSQAILVYLAGRLTDRAWWPEDAMSQATITQWLSVASSEVRNG
PNAARLIRKFGDPLDMGTAMRWTDKLLPLLNAHVETQDWFALGHPTIADCALFPYLALAP
EGGIDLTPYSALGRWFDRVRTLPGFVSMSGL
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
gtgtctccagttcttctatctccagccaaaggacacctcctgatgcttctctatgatctg
gacgtctccggaaactgctacaagatccggcttttcgcggccctgaccgatacgaagctg
gatctcgttccggtcgatctcgcggcaagtgagaaccacgattcggattttcggaaactg
aaccggttcggggaagtcccggttctggtggatggcgacctcaccctccgggactcccag
gccatcctggtttacctcgccggccgactgacggaccgcgcttggtggcctgaagacgcg
atgtcacaagccaccatcacacaatggctttcggtggcatccagcgaggtacgcaacggc
ccgaacgccgcccgtctgatccgcaaattcggtgatcccctcgatatgggcactgccatg
cgctggaccgacaaactcctgccgctgctcaatgcgcatgtcgagacacaggactggttt
gccctcggtcatcctacgatcgctgactgcgctctctttccctatctcgcactggcaccc
gagggtggtatcgaccttaccccctactcagctcttggacgctggttcgatcgcgtccgg
accttaccgggctttgtctccatgtctggtctctag

DBGET integrated database retrieval system