KEGG   Gluconobacter oxydans H24: B932_3343Help
Entry
B932_3343         CDS       T02348                                 

Definition
exodeoxyribonuclease
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
goh  Gluconobacter oxydans H24
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:goh03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3395205..3397391)
Genome map
AA seq 728 aa AA seqDB search
MSGRATDSSPTEALAGLVERVTFHNAENGFCVLRVKVRGQRDLVTVVGHAAMISAGEFVQ
MSGRWFNDHTHGLQFKAEFLKASPPTTVEGIERYLGSGMIRGIGPVYAKKLVKAFGEAVF
DLIEQEPHRLREVTGIGPKRAERIVGGWADQKVIREIMLFLHSNGVGTSRAVRIFKTYGQ
DAVQLISENPYRLAKDIRGIGFKTADQIARKMGIAPDAMIRVRAGISYALGEAMDEGHCG
LPVGELLTSTAELLEVAAPLIETALALELEAGDVIADSVGETGCIFLAGLYRAEQSIAER
LRACAVGRPPWPEIDAEKAMTWVEGKTGLALAPSQQEAVRLALRSKVLVITGGPGVGKTT
LVNAILKIVTAKGTDVQLCAPTGRAAKRLSESTGLEGKTIHRLLETDPATGSFKRDDTNP
LTCDLLVVDEASMVDVLLMRFLLRALPDSAALLIVGDVDQLPSVGPGQVLADIIGSDAVP
VVRLTEVFRQAAQSRIITNAHRINEGKMPELSAEEGSDFYFVEAAEPEVGLRKLLAVVKD
RIPARFGLDPVRDVQVLCPMNRGGLGARSLNIELQLALNPPGEVKVERFGWTYGPSDKVM
QIANDYDRDVFNGDLGVIDRIDIEEGELTVSFDGREVVYGFGELDELVLAYATTIHKSQG
SEYPAVVIPLVTQHYAMLARNLLYTGVTRGRKLVVLVGQKKALAIAARNQGGRRRWSKLR
EWLADNVA
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggcgcgccaccgactcttcgcccacggaagcgctggcaggactggtcgagcgg
gtgacgttccacaatgctgagaacggtttttgtgttctgcgggtgaaagtgcgggggcag
cgcgatctggtcactgttgtcggccatgccgccatgatatcggcgggcgagttcgtgcag
atgtcggggcgctggttcaacgaccacacccacggcctccagttcaaggcggaatttctc
aaggccagcccgccgaccacggtcgagggcatcgaacgctatctgggctccggcatgatc
cggggcattggtcccgtctatgccaaaaagctggtgaaagcgttcggcgaggcggtgttc
gacctgatcgaacaggaaccgcaccgcctgcgggaggtgacgggcattggccccaagcgt
gccgagcgtattgtcggtggctgggcggaccagaaggtgatccgcgagatcatgctattt
ctgcacagcaacggcgtcggcacgtcgcgggcggtgcggatcttcaagacctacggtcag
gacgcggttcaactgatcagtgagaacccctatcggctggcgaaagatattcgcgggatc
ggattcaaaaccgctgaccagattgcccggaagatggggatcgcacccgacgccatgatc
cgggtgagggccgggatctcctacgcgctcggcgaggccatggatgaagggcattgcggg
ctgcctgtgggagagttgctgaccagcaccgccgaactgctggaggtcgccgcccctttg
atcgagacggcgctcgcgctggaactggaagcgggagacgttattgccgacagcgtgggc
gagacgggatgcattttccttgctggtctctatcgcgctgagcagagcattgcggagcgg
ctgcgcgcctgcgccgtgggtcgaccgccctggccggagatcgacgctgaaaaggccatg
acctgggtggaaggcaagaccgggctcgctctggctcccagccagcaggaagcagtgcgt
cttgccctgcgcagcaaggtgctggtgatcacgggtggccccggcgtcggcaagaccacg
ctggtcaacgccatcctgaagatcgtaacggccaagggtacggatgtgcagctttgtgcg
ccgaccggtcgcgcggcaaaacgcctgtcggaaagcaccggactggaaggcaagaccatc
caccgcctgctggagacggatccggcgactggcagtttcaagcgggacgataccaaccca
ctgacctgcgatctgctggtcgtggacgaagccagcatggtggacgtgctgctgatgcgt
ttcctgctgcgtgcgttgcccgacagcgccgccctgctgatcgtgggcgacgtggaccag
ttgccgtcggtcgggccggggcaggtgctggccgacatcatcggctcggacgccgtaccg
gtggtgcggctgaccgaggtgttccgccaggcggcgcagagccggatcatcaccaatgcc
caccggatcaacgaagggaagatgcccgaactgagtgctgaagagggatcggatttctat
ttcgttgaggctgctgagcccgaggttgggctgcgcaagttgctggctgtggtgaaggat
cgcatcccggcgcggttcgggctggacccagttcgcgacgtgcaggtgctctgcccgatg
aaccggggcggccttggggcgcggtcgctgaatatcgaattgcagctggcgctgaacccg
cctggcgaggtgaaggtcgagcggttcggctggacctacggtcctagcgacaaggtcatg
cagatcgccaacgattatgaccgggacgttttcaacggggatcttggcgttatcgacagg
atcgatatcgaagaaggtgaactgaccgtctcattcgatggacgggaggtcgtttacggt
tttggggagctggatgaactggtgctggcctacgccaccacgatccacaagagccaggga
tcggaatatccggcggtggttatcccgctggtgacgcagcattacgccatgctggcgcgg
aacctgctctacaccggcgtcacacggggacggaagctcgtcgtgctcgtggggcaaaag
aaggcgctggccatcgctgcgcggaaccagggcggcagacggcggtggtcgaagctcagg
gagtggctggcggataatgtcgcatga

DBGET integrated database retrieval system