KEGG   Gordonia sp. KTR9: KTR9_0072Help
Entry
KTR9_0072         CDS       T02216                                 

Definition
Acyl-coenzyme A synthetase/AMP-(fatty) acid ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
gor  Gordonia sp. KTR9
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gor00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KTR9_0072
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KTR9_0072
   00620 Pyruvate metabolism
    KTR9_0072
   00640 Propanoate metabolism
    KTR9_0072
  Energy metabolism
   00680 Methane metabolism
    KTR9_0072
Enzymes [BR:gor01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     KTR9_0072
Lipid biosynthesis proteins [BR:gor01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   KTR9_0072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(73190..74767)
Genome map
AA seq 525 aa AA seqDB search
MTQATTTPTDLVDRWLAIYGAPDADAASLLVDGHDPDAVAFTVIEVEQTGDHQSGDVRPV
TTDVTYGELAERSKRLASALAELGVGRGDTVGVLMGKREELVVSLLAIARLGAVYIPLFT
AFATPAIEMRLQAGAAKVVITEPSQADKLSGIDGITTVVAGEQFEDLIASHDAVTESVAV
GGDGTLILLFTSGTTGAPKGVPVPVKALASFVAYMHFGLDVQADDVFWNAADPGWAYGLY
YGVLGPLAAGRRNLLLHAGFTPELTAKILGDLGVTNFAAAPTVYRSLSKDSRISGFSLRR
ASSAGEPLTPDVIDWALGAIGTEVRDHYGQTEHGMFINNHWHESVHETLVPGSMGRPMPG
FAAGVVDGQIAIDVPASPLMWFSGYLDAPEKTEQRFSPDGRWYLTGDTGRVDDEGRYFFT
ARDDDVIIMAGYRIGPFDVESVLITHPSIIDVAVVGRPDELRGEVLEAFVVLADGVEGTD
ALETELQQLVKTRFAAHAYPRTVHFVDALPKTPSGKIQRFLLRQR
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgacacaggccaccacgacccccaccgacctggtcgaccgctggttggcgatctacggg
gcgcccgacgccgacgccgcgtcgcttctcgtcgacggacacgatcccgacgcggtcgcc
ttcaccgtgatcgaggtcgagcagaccggcgatcaccagtccggcgacgtccgaccggtc
accactgatgtcacctacggcgagctggccgagcggtccaagcgactcgcctcggctctc
gcggagctgggcgtcggtcgcggcgacacggtgggcgtcctcatgggcaagcgcgaggag
ctcgtcgtctcgctgctggcgatcgctcgcctcggcgcggtctacatcccgctgttcacc
gccttcgcgacccccgcgatcgagatgcgcctgcaggccggtgccgcgaaggtcgtcatc
accgagccgagtcaggcggacaagctctccgggatcgacggcatcaccacggtggtcgcc
ggcgagcagttcgaagatctcatcgcctcgcacgacgcggtcaccgagtcggtcgcggtc
ggcggcgacgggacgttgatcctgctcttcaccagcggtaccaccggtgcgccgaagggc
gttcccgtgccggtcaaggcgctcgcctcgttcgtcgcctacatgcacttcggtctcgac
gtccaggccgacgacgtgttctggaacgccgccgaccccggctgggcctacgggctgtac
tacggtgtgctcggcccgctggcggccgggcggcgcaatctgctgctgcacgccggattc
acccccgaactcaccgccaagatcctcggcgacctcggcgtcaccaacttcgcggcggca
ccgaccgtctaccgctcgctcagcaaggactcgcgcatctccgggttctcgctccgccgg
gcatcctcggccggtgaacccctgacccctgacgtcatcgactgggcgctgggcgccatc
ggcaccgaggtccgcgaccactacgggcagaccgagcacggcatgttcatcaacaaccac
tggcacgagtcggtccacgagaccctggtcccgggttcgatgggccggccgatgcccggc
ttcgcggcgggcgtcgtcgacggccagatcgccatcgacgtcccggccagcccgctgatg
tggttctcgggctacctcgacgccccggagaagaccgagcagcggttctcccccgacggc
cggtggtacctgaccggcgacaccggccgggtggacgacgagggccgctacttcttcacc
gcacgcgacgacgacgtgatcatcatggccgggtaccggatcggcccgttcgacgtcgag
agcgtcctgatcacccacccgtcgatcatcgacgtcgccgtcgtgggccgtcccgacgag
ctccgtggcgaggtcctggaggcgttcgtcgtcctcgcggacggggtcgagggcaccgat
gctctcgaaaccgagcttcagcagttggtcaagacgaggttcgccgcgcacgcctatccg
cgcaccgtgcacttcgtcgacgccctgcccaagaccccgagcggcaagatccaacggttc
ctgctgcgccagagatga

DBGET integrated database retrieval system