KEGG   Gordonia sp. KTR9: KTR9_0251Help
Entry
KTR9_0251         CDS       T02216                                 

Definition
Arginase / agmatinase / formimionoglutamate hydrolase, arginase family
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
gor  Gordonia sp. KTR9
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:gor01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:gor00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
296742..297641
Genome map
AA seq 299 aa AA seqDB search
MKITVLGAPSSAGAYCVGVERAPAALRDAGLVEQLAATGAEVVDAGDLTTRLWFPDRESP
FAQNLSDETDALIELSAAAADLLAAGQRLLVLGGSCTVAVGMCAAMALCGERPRIVYVDR
HLDLNTPRSTAEGSLSWMGMAHALALEGAAPELVGLTNRTPILHPSDLAYLGVDVTRETT
GWEREQATALGLAIVDQTRLCDDPEDAARGARSMLAPGPFAVHLDVDVLDFLDAPIAENV
NGRNSGPTIAVLEQALVTLLRDPDCLGMSIGQLDPAHASADHTAVPRLVAALVSALTFT
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtgaagatcacggtgttgggcgcgccgagcagtgctggtgcctactgtgtgggcgtagag
cgagcgcccgctgcgttgcgagatgctggtctcgtcgagcagttggcggccaccggcgcg
gaggtcgtcgatgcgggggatctgacaacccggttgtggtttcccgaccgcgagagtccg
ttcgcgcagaacctgagcgacgagacggatgcactgatcgagctctccgcagctgcggcc
gacctgctcgcagccgggcagcgtctgctcgtgctcggcggaagctgcacggttgcggtc
gggatgtgcgccgcgatggcattgtgcggggagcgcccccgcatcgtctacgtggaccgg
catcttgatctcaatacgccacgctcgacagcggagggttcgctgagctggatgggtatg
gcgcacgcgttggccctcgagggggctgcgcccgaattggtcggcctcacgaaccgcacg
ccgatactgcacccgtcggacctggcctatctcggggtggatgtgacccgggagacaacc
gggtgggaacgcgaacaggccactgcgctgggacttgcaatcgtcgatcagacgaggctc
tgcgacgaccctgaagacgcggcccgcggcgcgcgaagcatgctcgcccccggaccgttc
gcggtgcacctcgacgtcgacgtgctcgatttcctggacgcgccgatcgccgagaacgtg
aacggacggaacagtggaccgacgattgcggtcctcgaacaggccctggtcacgctcctg
cgcgacccggattgtctggggatgtcgatcgggcagctggaccccgcgcacgcgtcagcg
gatcacaccgcggtaccccggctcgttgcggcgctcgtgtcggcactgaccttcacctag

DBGET integrated database retrieval system