KEGG   Gordonia sp. KTR9: KTR9_0251Help
Entry
KTR9_0251         CDS       T02216                                 

Definition
Arginase / agmatinase / formimionoglutamate hydrolase, arginase family
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
gor  Gordonia sp. KTR9
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gor00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KTR9_0251
  Amino acid metabolism
   00330 Arginine and proline metabolism
    KTR9_0251
Enzymes [BR:gor01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     KTR9_0251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
296742..297641
Genome map
AA seq 299 aa AA seqDB search
MKITVLGAPSSAGAYCVGVERAPAALRDAGLVEQLAATGAEVVDAGDLTTRLWFPDRESP
FAQNLSDETDALIELSAAAADLLAAGQRLLVLGGSCTVAVGMCAAMALCGERPRIVYVDR
HLDLNTPRSTAEGSLSWMGMAHALALEGAAPELVGLTNRTPILHPSDLAYLGVDVTRETT
GWEREQATALGLAIVDQTRLCDDPEDAARGARSMLAPGPFAVHLDVDVLDFLDAPIAENV
NGRNSGPTIAVLEQALVTLLRDPDCLGMSIGQLDPAHASADHTAVPRLVAALVSALTFT
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtgaagatcacggtgttgggcgcgccgagcagtgctggtgcctactgtgtgggcgtagag
cgagcgcccgctgcgttgcgagatgctggtctcgtcgagcagttggcggccaccggcgcg
gaggtcgtcgatgcgggggatctgacaacccggttgtggtttcccgaccgcgagagtccg
ttcgcgcagaacctgagcgacgagacggatgcactgatcgagctctccgcagctgcggcc
gacctgctcgcagccgggcagcgtctgctcgtgctcggcggaagctgcacggttgcggtc
gggatgtgcgccgcgatggcattgtgcggggagcgcccccgcatcgtctacgtggaccgg
catcttgatctcaatacgccacgctcgacagcggagggttcgctgagctggatgggtatg
gcgcacgcgttggccctcgagggggctgcgcccgaattggtcggcctcacgaaccgcacg
ccgatactgcacccgtcggacctggcctatctcggggtggatgtgacccgggagacaacc
gggtgggaacgcgaacaggccactgcgctgggacttgcaatcgtcgatcagacgaggctc
tgcgacgaccctgaagacgcggcccgcggcgcgcgaagcatgctcgcccccggaccgttc
gcggtgcacctcgacgtcgacgtgctcgatttcctggacgcgccgatcgccgagaacgtg
aacggacggaacagtggaccgacgattgcggtcctcgaacaggccctggtcacgctcctg
cgcgacccggattgtctggggatgtcgatcgggcagctggaccccgcgcacgcgtcagcg
gatcacaccgcggtaccccggctcgttgcggcgctcgtgtcggcactgaccttcacctag

DBGET integrated database retrieval system