KEGG   Gordonia sp. KTR9: KTR9_0346Help
Entry
KTR9_0346         CDS       T02216                                 

Definition
Ribulose-5-phosphate 4-epimerase-related epimerase and aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
gor  Gordonia sp. KTR9
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gor00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    KTR9_0346
Enzymes [BR:gor01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     KTR9_0346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(405327..405992)
Genome map
AA seq 221 aa AA seqDB search
MPMSAPSLRDQVADVARRLAAEGLLIGTAGNVSVRVDDHLAITGTGVVLADCSAYDVTVV
SLSGDVVDGSVAPSSELDLHCRVYERTDAQAIVHTHAPFGTAVACVSGLTSLPVLHYQQL
GLGGAIPIAPYATFGSPELADIVADALVDTQVALMANHGSVARGSSLADAVENALLLEWL
ATLFHRTCSMGRPRELTADEQQSTVAQAVRLDYGTPQEKRT
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgccgatgagtgccccgtcgctgcgcgaccaggtcgccgatgtcgctcgacggctggcc
gccgaaggcctgctgatcggcaccgccggaaacgtctcggtacgcgtagacgaccacctc
gcgatcaccggaacgggggtcgttctcgcggactgttcggcgtacgacgtcaccgtcgtg
tccctctccggcgacgtcgtggacgggtcggttgcgccgtcctcggagctcgacctgcac
tgtcgtgtgtacgagcggacggatgcgcaggcgatcgtgcacacccacgcacccttcggc
accgcggtcgcctgcgtcagcgggctgacgtcgctgccggtgctgcactatcagcagctc
ggcctcggcggcgcgatcccgatcgcgccgtatgcgacattcggcagccccgaactggcc
gacatcgtcgccgacgcactggtcgacacccaggtcgcgctgatggcgaatcatggttcg
gtggcacgaggctcgagcctggccgacgccgtggagaatgcgctgctgctggagtggctg
gccactctcttccaccggacctgcagcatgggccggccccgtgagctgaccgccgacgag
caacagtccaccgtcgcccaggcggtccgactggactacgggacgccccaggagaaacgc
acgtga

DBGET integrated database retrieval system