KEGG   Gordonia sp. KTR9: KTR9_0363Help
Entry
KTR9_0363         CDS       T02216                                 

Definition
Recombinational DNA repair protein (RecF pathway)
Orthology
K06187  
recombination protein RecR
Organism
gor  Gordonia sp. KTR9
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gor00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    KTR9_0363
DNA repair and recombination proteins [BR:gor03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      KTR9_0363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
425035..425646
Genome map
AA seq 203 aa AA seqDB search
MYEGPIQDLIDQLAKQPGLGPKGAQRIAFHLLAGEKSDIDRLIAALGRVRDDVVFCAECG
NVSANRLCRICSDSRRDASKICVVEEPKDVHAIERTKEFTGRYHVLGGALDPLSGIGPDQ
LRIRELLRRLANQEDGVDVSEVIVATDPNTEGEATATYLQRMLRDFPGLSVTRLASGLPM
GGDLEFADELTLGRALSGRRILA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgtatgagggaccgatccaggacctgatcgaccaactggccaaacagccggggctcggt
ccgaagggcgcgcagcggatcgccttccacctgctggccggggagaagtccgacatcgat
cgcctcatcgccgcgctcggccgggtccgcgacgacgtcgtgttctgtgccgagtgcggg
aacgtgtcggcgaaccgcctctgccggatctgttcggactcgcgtcgcgacgccagcaag
atctgcgtcgtcgaggagccgaaggacgtgcacgcgatcgaacggaccaaggagttcacc
ggtcggtatcacgtgctcgggggtgcgctcgacccgttgtcgggaatcggacccgaccag
ttgcgcatccgcgaactgctgcgccggctggccaaccaggaggacggggtcgacgtctcc
gaggtgatcgtcgccaccgatccgaacaccgagggcgaagcgaccgcgacctacctccag
cgcatgctcagggacttcccgggtctgtcggtcacccggctcgcgtcggggctgccgatg
ggcggcgacctcgagttcgccgacgaactcaccctcggccgcgctctgtcgggtcgtcgc
atcttggcgtga

DBGET integrated database retrieval system