KEGG   Gordonia sp. KTR9: KTR9_0471Help
Entry
KTR9_0471         CDS       T02216                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase-related enzyme
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
gor  Gordonia sp. KTR9
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:gor00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:gor00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
537146..537763
Genome map
AA seq 205 aa AA seqDB search
MKVRPLAVEGAWEFTPVQHGDARGLFAEAFKADVLAEAIGHRFDLAQVNLSVSAAGVLRG
VHFADVPPGQAKYVTCPGGAILDVIVDIRVGSPTFGAYDTVLLDDVDRRAVYLSEGLGHA
FCSLADNSTVTYLCSTGYNPTGEHGINPLDPELDIEWPTQARDGSPLEFELSPKDTAAPG
LSEARESGLLPRYDEVADHLRSRRD
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtccgcccactcgccgtcgagggcgcctgggagttcaccccggtccagcacggt
gatgcccgtgggttgttcgccgaggcgttcaaagccgatgtcctcgccgaggccatcggt
caccgcttcgatctcgcgcaggtgaacctctcggtctccgccgccggtgtgctccgcggt
gtccacttcgccgacgtcccaccggggcaggcgaagtacgtcacctgccccggcggcgcg
atcctcgatgtcatcgtcgacatccgcgtcggctcacccaccttcggcgcctacgacacc
gtcctgctcgacgatgtcgaccgtcgagcggtctacctctccgaaggcctcggacacgcg
ttctgctcactcgccgacaactcgaccgtgacctacctctgctccaccggatacaacccg
accggcgaacacggcatcaacccgctcgaccccgaactcgacatcgagtggccgacgcag
gcgcgcgacggttcaccgctggagttcgaactgtccccgaaggacaccgccgcgccgggt
ctctcggaggcccgtgagtcgggtctgctcccgcgttacgacgaggtggccgaccacctc
cgctcgcgacgcgactga

DBGET integrated database retrieval system