KEGG   Gordonia sp. KTR9: KTR9_0648Help
Entry
KTR9_0648         CDS       T02216                                 

Definition
Isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
gor  Gordonia sp. KTR9
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:gor00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KTR9_0648
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    KTR9_0648
Enzymes [BR:gor01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     KTR9_0648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
731057..732352
Genome map
AA seq 431 aa AA seqDB search
MSNVGKPRTAAEIQQDWDTNPRWKGIKRDYTAEQVAELQGSVVEEHTLARRGAEILWDGV
TQGDGSYINALGALTGNQAVQQVRAGLKAVYLSGWQVAGDANLSGHTYPDQSLYPANSVP
SVVRRINNALLRADEIARVEGDNSVDNWVVPIVADGEAGFGGALNVYELQKAMIAAGAAG
THWEDQLASEKKCGHLGGKVLIPTQQHIRTLNSARLAADVAGVPTVVIARTDAEAATLIT
SDVDDRDKQFVTGERTAEGYYHVKNGIEPCIERAKSYAPYADMIWMETGTPDLELARKFA
EAVKSEYPDQLLSYNCSPSFNWSKHLDDSTIAKFQNELGAMGFTFQFITLAGFHSLNYGM
FDLAYGYAREQMSAFVDLQNREFKAAEERGFTAVKHQREVGAGYFDNIATTVDPNSSTTA
LKGSTEEGQFH
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgtcggaaagccccgtaccgccgcggagatccagcaggactgggacaccaac
ccgcgctggaagggcatcaagcgtgactacaccgccgagcaggtcgccgagctccagggc
tcggtcgtcgaggagcacaccctcgcccgtcgtggcgcagagatcctgtgggacggcgtg
acccagggtgacggcagctacatcaacgcactgggcgccctcaccggcaaccaggccgtg
cagcaggtccgcgccggcctgaaggccgtgtacctctcgggctggcaggtcgcaggcgac
gccaacctctccggtcacacctaccccgaccagtcgctctacccggccaactcggtgccg
agcgtcgtgcgtcgtatcaacaacgcgctgctgcgcgccgacgagatcgcccgcgtcgag
ggtgacaactcggtcgacaactgggtcgtcccgatcgtcgccgacggcgaggccggcttc
ggtggcgcgctcaacgtctacgagctgcagaaggccatgatcgccgcgggtgccgccggc
acccactgggaggatcagctcgcctcggagaagaagtgcggccacctcggtggcaaggtg
ctcatcccgacccagcagcacatccgcacgctgaactcggctcgtctcgccgccgacgtc
gccggtgttcccaccgtcgtcatcgcccgcaccgacgccgaggccgccacgctgatcacc
tccgacgtcgacgaccgcgacaagcagttcgtcaccggtgagcgcaccgccgagggctac
taccacgtgaagaacggcatcgagccgtgcatcgagcgtgcgaagtcctacgctccctac
gccgacatgatctggatggagaccggtacccccgatctcgagctggctcgcaagttcgcc
gaggccgtcaagagcgagtaccccgaccagctgctgtcctacaactgcagcccgtcgttc
aactggagcaagcacctcgacgacagcaccatcgccaagttccagaacgagctgggcgcc
atgggcttcaccttccagttcatcaccctggccggcttccactcgctgaactacggcatg
ttcgacctggcctacggctacgcccgcgagcagatgtcggcgttcgtcgacctgcagaac
cgcgagttcaaggctgccgaggagcgcggcttcaccgccgtcaagcaccagcgtgaggtc
ggcgccgggtacttcgacaacatcgccaccaccgtcgatccgaacagctcgaccaccgcg
ctgaagggctcgaccgaggaaggacagttccactag

DBGET integrated database retrieval system