KEGG   Gordonia sp. KTR9: KTR9_0759Help
Entry
KTR9_0759         CDS       T02216                                 

Definition
Glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
gor  Gordonia sp. KTR9
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:gor00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    KTR9_0759
  Metabolism of other amino acids
   00480 Glutathione metabolism
    KTR9_0759
Enzymes [BR:gor01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     KTR9_0759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
847084..847566
Genome map
AA seq 160 aa AA seqDB search
MANIKDIPVSALDGSDVSLNDFGGPLLVVNVASKCGLTPQYAGLEELAKTYGDKGLTVVG
VPCNQFMGQEPGTAEEIATFCSATYGVTFPLLEKTDVNGDGRHPLYAELTQHADADGEAG
DIQWNFEKFLVNADGEVVNRFRPRTEPTDPTVIAAIESVL
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggccaacatcaaggacatcccggtttctgcactcgacggttcggacgtctcgctgaac
gacttcggcggaccgcttctcgtggtgaacgtcgccagcaagtgcggtctcacgccgcag
tacgccggcctggaggagctcgccaagacatacggggacaaagggctcaccgtcgtcgga
gtgccgtgcaaccagttcatggggcaggagccgggtactgccgaggagatcgcgaccttc
tgctcggcgacctacggtgtgaccttcccgctgctcgagaagaccgacgtcaacggcgac
ggtcgccacccgctgtacgccgaactcacccaacacgccgacgccgacggcgaagcgggc
gacatccagtggaacttcgagaagtttctcgtcaacgccgacggcgaggtcgtcaaccgc
ttccgtccgcgcaccgagccgaccgacccgacggtcatcgccgccatcgaatccgtgctc
tga

DBGET integrated database retrieval system