KEGG   Gordonia sp. KTR9: KTR9_0811Help
Entry
KTR9_0811         CDS       T02216                                 

Gene name
hsaG
Definition
Acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
gor  Gordonia sp. KTR9
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gor00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    KTR9_0811 (hsaG)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KTR9_0811 (hsaG)
   00650 Butanoate metabolism
    KTR9_0811 (hsaG)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    KTR9_0811 (hsaG)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KTR9_0811 (hsaG)
   00622 Xylene degradation
    KTR9_0811 (hsaG)
   00621 Dioxin degradation
    KTR9_0811 (hsaG)
Enzymes [BR:gor01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     KTR9_0811 (hsaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
903891..904796
Genome map
AA seq 301 aa AA seqDB search
MAAKLTAAIIGSGNIGTDLMYKLERSEVIEPRWMVGIDAASEGMKRAADHGLITMSGGAD
ELLASSERPDLIFEATSAYVHREYAPKYEEAGIVAVDLTPAAVGPAVVPPANLREHLDAP
NTNMITCGGQATIPMVHAVSSVVPVPYAEIVASVASVSAGPGTRANIDEFTATTSKGVET
IGGAQRGKAIIILNPADPPMIMRDTIFCAIPEDADTDAIAESIHRREKEIQAYVPGYRLL
QDPQFDPPSVLNGGHARVSIFVEVEGAGDFLPPYAGNLDIMTAAATKVGEEIAKTKLGVP
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
gtggcagccaagctgaccgcagcgatcatcgggtcgggcaacatcggcaccgacctgatg
tacaagctggagcgctccgaggtgatcgagccgcgctggatggtcggcatcgatgccgcc
tccgagggcatgaagcgcgcggctgatcatggcctgatcacgatgagcggcggcgccgac
gagctgttggcgtcgtcggagcgtccggatctgatcttcgaggcgacctcggcctatgtg
caccgcgaatacgcgccgaagtacgaggaggcgggcatcgtcgccgtcgacctcaccccg
gccgctgtcggacccgcagtggtgccgccggccaatctccgtgagcatctcgacgcgccg
aacaccaacatgatcacgtgcggcggtcaggcgaccatcccgatggtgcatgcggtgagt
tcggttgtgccggtgccgtatgccgagatcgtcgcgtccgtggcctcggtgtcggccggg
ccgggcacccgcgccaacatcgacgagttcacggccaccacctccaagggcgtggagacg
atcggcggtgcgcagcgcggcaaggcgatcatcatcctcaatccggccgacccgccgatg
atcatgcgcgacaccatcttctgcgccatccccgaagatgcggacacagatgcgatcgcc
gagtcgattcaccgacgggagaaagagatccaggcgtacgtgccgggttatcgactgctc
caggacccccagttcgatccgccgagcgttctgaacggcggacatgcccgggtgtcgatc
ttcgtcgaggtcgagggtgcgggcgacttcctgccgccctacgccgggaatctggacatc
atgaccgctgccgccacgaaggtcggcgaagagatcgcgaagacgaagctgggagtcccc
gcatga

DBGET integrated database retrieval system