KEGG   Gordonia sp. KTR9: KTR9_0835Help
Entry
KTR9_0835         CDS       T02216                                 

Definition
3'-Phosphoadenosine 5'-phosphosulfate 3'-phosphatase (PAPS)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
gor  Gordonia sp. KTR9
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:gor00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
929316..930095
Genome map
AA seq 259 aa AA seqDB search
MTDDRALAGELATAAGELLLDIRRSSGLTGKELGQEGDRRSDEFILGRLAKERPDDAVLS
EESADDKSRLSASRVWIIDPVDGTREYGTYEPGGGRTDWAVHVALWSADEGLIAGAVALP
ALGVTYLDDGSAVEPVEGLASRPRTGVPRVVVSSSRPPAFADEVAAAMAGEVLPMGSAGA
KAMAVVRGEADAYVHAGGQYEWDSAAPVAVAKAKGLWCGRIDGSPLVYNNEDTYLPDLVI
CRPEFTEAILTVTTEGAGG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacgatcgtgccctggccggtgaactggccaccgccgcaggtgaactcctgctc
gacatccggcgctccagcggattgacgggcaaagagctcggtcaggagggtgaccggcgg
tccgacgagttcatcctcgggcggctcgcgaaggagcgcccggacgacgcggtgctgtcc
gaggagtcggccgacgacaagtcgcggctgtcggcgtcgcgcgtgtggatcatcgatccg
gtcgacggcacccgcgagtacggcacgtacgaacccggcggcggtcggacggactgggcc
gtgcacgtcgcgctctggtcggcggacgagggactgatcgcgggtgcggtcgcgctgccg
gccctcggggtgacctatctcgacgacggttcggccgtcgagcccgtggagggccttgcg
tcacgcccccggaccggtgtcccgcgcgtcgtcgtgagcagttcacgcccaccggccttc
gccgacgaggtggccgcggccatggcgggcgaggtgctgccgatggggtccgccggggcg
aaggcgatggcggtcgtgcgcggtgaggccgacgcgtacgtccacgccggcggccagtac
gagtgggattcggccgcgcccgtcgccgtcgcgaaggcaaagggcctgtggtgcggtcgg
atcgatggttcgccgctcgtctacaacaacgaggacacctacctgcccgacctcgtcatc
tgccggccggagttcaccgaggcgatcctcacggtcaccaccgagggcgcgggcggctga

DBGET integrated database retrieval system