KEGG   Gordonia sp. KTR9: KTR9_0915Help
Entry
KTR9_0915         CDS       T02216                                 

Definition
Delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
gor  Gordonia sp. KTR9
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:gor00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1021010..1021987
Genome map
AA seq 325 aa AA seqDB search
MPPVIRPRRLRTTPAMRRLVAETSLEPRHLVLPMFVADGIAEPVPISSMPGVVQHTMESL
RGAAAEAVAAGVGGLMLFGVPRPEDKDATGSGADAEDGILNRALRTLADDLGDATVLMAD
TCLDEFTDHGHCGVVDDRGRVDNDETLERYVSMSLAQARAGAHLLGPSGMMDGQVATIRA
ALDAEGFTDTGILAYAAKYASAFYGPFREAVGSSLQGDRRTYQQDAANRVEALREVRLDL
EEGADIVMVKPAMSYLDIVRDVADMSDVPVAAYQISGEYSMISAAAERGWIDRDAAILES
LTSIRRAGASIVLTYWAAEVAQRLS
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgccacccgtgattcggccccggcggttgcgtaccaccccggcgatgcgccggctggtc
gccgagacctcactcgagccgcgacatctggtgctgccgatgttcgtcgccgacggcatc
gccgagccggtgccgatctcgtcgatgccgggcgtcgtacagcacacgatggagtcgcta
cgcggtgccgcggccgaggcggtcgcggccggcgtcggcggactgatgctgttcggcgtg
ccgcgtccggaggacaaggacgccaccggttccggggccgacgccgaggacgggatcctc
aaccgggccctgcgcaccctggccgacgatctcggggatgcgacggtgctgatggccgac
acatgcctcgacgagttcaccgatcacgggcactgcggcgtcgtcgacgaccgtggtcgc
gtcgacaacgacgagaccctcgagcgctatgtctcgatgtccctggcccaggcgcgggca
ggtgcgcatctcctcgggccgagcgggatgatggacggtcaggtcgccaccatccgggcc
gctctcgacgcggagggcttcaccgacaccgggatcctggcctacgccgcgaagtacgcc
tcggccttctacggcccgttccgggaagcggtcggctcgtcgttgcagggggaccggcga
acgtaccagcaggatgcggccaaccgggtcgaggcgctgcgcgaggtccgcctggacctc
gaggagggcgccgacatcgtgatggtgaagcccgcgatgagctacctcgacatcgtgcgc
gacgtcgccgacatgagcgacgtcccggtcgcggcgtaccagatcagcggcgaatactcg
atgatctccgccgccgccgaacgcggctggatcgaccgcgacgccgcgatcctggagtcg
ctgacctcgatccggcgggccggcgcgtcgatcgtcctgacctactgggcggccgaggtg
gcacagcgcctgtcgtga

DBGET integrated database retrieval system