KEGG   Gordonia sp. KTR9: KTR9_1236Help
Entry
KTR9_1236         CDS       T02216                                 

Definition
3'-Phosphoadenosine 5'-phosphosulfate (PAPS) 3'-phosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
gor  Gordonia sp. KTR9
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gor00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    KTR9_1236
Enzymes [BR:gor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     KTR9_1236
Transfer RNA biogenesis [BR:gor03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    KTR9_1236
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1402740..1403507)
Genome map
AA seq 255 aa AA seqDB search
MPPVCSSCGMNSRLSDAELAARIAQGAGEVLLGIRSGDLLGGAMLGDVGDALAQAWISTV
LRKHRPRDAVLSEEAADVGDRATAARVWIIDPLDGTREFAAGSADWAVHVALTESGIVTE
ASVSLPATGELFRSDTVARTAGELTRRLVTSRWGGSYETSYVANRLGLQMVPVGSAGAKA
MAVVRGDADAYVHAGGQYEWDNAAPVGVALAAGLHCSRLDGSEIVYNNRHPYMPDFVICR
SEIRDEMLAALQQIW
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgccaccagtgtgctctagttgtgggatgaactcccgactttccgacgccgaactggct
gcccggatcgcgcagggagccggagaggtacttctcggaatccggtccggtgatctgctc
ggcggggcgatgctcggcgacgtgggcgatgcgcttgcgcaggcgtggatctcgacggtg
ctgcgcaaacaccggccacgcgatgcggtgctgtccgaggaagcggccgacgtcggcgac
cgggccaccgcggctcgggtgtggatcatcgaccccttggacggcacaagggaattcgcc
gcgggttcagcggactgggccgtacacgtggccctgaccgagagcgggatcgtcaccgag
gcgtcggtgtccctgcccgcgacgggtgaactgtttcgttcggacacggtcgcacggacc
gcgggcgagctgacccgccgcctggtcacctcccggtggggcggctcctacgagaccagc
tacgtggcgaaccgtctgggtctgcagatggtgccggtcggttcggccggggccaaggcg
atggccgtcgtccgcggcgatgccgacgcctacgtccacgccggcggccaatacgagtgg
gacaacgcggcgccggtgggagtcgccctggcggccggcctgcactgcagtcgactcgac
gggtcggagatcgtctacaacaaccggcatccgtacatgccggacttcgtcatctgccgc
agcgagatccgcgacgagatgctcgccgcgttgcagcagatctggtga

DBGET integrated database retrieval system