KEGG   Gordonia sp. KTR9: KTR9_1247Help
Entry
KTR9_1247         CDS       T02216                                 

Definition
Succinyl-CoA synthetase, beta subunit
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
gor  Gordonia sp. KTR9
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:gor01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:gor00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:gor00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:gor00660]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1416491..1417654
Genome map
AA seq 387 aa AA seqDB search
MDLFEYQAKELFAKHGVPTTPGRVTDDAADARAIAEEIGKPVMIKAQVKTGGRGKAGGVK
YAATPDDAQSHASNILGLDIKGHVVKKLLVAEASDIAEEYYISFLLDRTNRSYLAMCSVE
GGMEIEEVAATKPERLARVAVDAVKGVDLETARSIAEQGHLPAEVLDAAAVTIAKLWEVF
VKEDATLVEVNPLVRTPDDQILALDGKVTLDANADFRQPGHEEFEDRDATDPLELKAKEN
DLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGEKHNNVKPANFLDIGGGASAEVMAAGLD
VILGDEQVKSVFVNVFGGITACDAVANGIVGALEKLGSDANKPLVVRLDGNKVDEGRKIL
ADANHPLVTLAETMDSGADKAAELASK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggatctcttcgaataccaggcgaaggaactgttcgccaagcacggggttcccaccaca
cccggtcgggtgaccgatgatgccgccgacgcgcgggcgatcgccgaggaaatcggcaag
cctgtgatgatcaaggcgcaggtcaagaccggcgggcgtggcaaggcaggcggcgtcaag
tacgccgcgaccccggacgacgcgcagtcccacgcttccaacatccttggcctcgacatc
aagggccatgtcgtcaagaagctgctggtcgccgaggccagcgacatcgcggaggagtac
tacatctccttcctgctcgatcgcaccaaccgctcgtacctggccatgtgctcggtcgag
ggcggtatggagatcgaagaggtcgccgcaaccaagcccgagcgcctcgcgagggtcgcc
gtcgacgccgtgaagggtgtcgatctggaaaccgcgcgctcgatcgccgagcagggccat
ctgcccgccgaggtgctcgacgccgcagcggtcaccatcgccaagctctgggaggtgttc
gtcaaggaggacgccaccctggtcgaggtcaatccgctcgtccgcacgccggacgatcag
atcctcgccctcgacggcaaggtcaccctcgatgccaacgccgacttccgtcagcccggc
cacgaggagttcgaggatcgcgacgccaccgatcccctggagctcaaggccaaggaaaac
gacctcaactacgtcaagctcgacggtgaggtcggcatcatcggcaacggcgcgggcctg
gtcatgtcgaccctcgacgtggttgcctacgccggtgagaagcacaacaacgtgaagccc
gcgaacttcctcgacatcggcggcggcgcctcggccgaggtcatggctgccggtctcgac
gtcatcctcggcgacgagcaggtcaagagcgtcttcgtcaacgtcttcggcggcatcacc
gcgtgtgacgccgtcgccaacggcatcgtcggggccctggagaagctggggtcggacgcc
aacaagccgctggtcgtccgcctcgacggcaacaaggtcgacgaaggccgcaagatcctg
gccgatgcgaaccacccgttggtcacgctcgccgaaaccatggactcgggcgccgacaag
gccgccgagctggcgagcaagtaa

DBGET integrated database retrieval system