KEGG   Gordonia sp. KTR9: KTR9_1293Help
Entry
KTR9_1293         CDS       T02216                                 

Definition
Mg-chelatase subunit ChlI
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
gor  Gordonia sp. KTR9
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:gor00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1467387..1468715
Genome map
AA seq 442 aa AA seqDB search
MRDEIRNNLLSALREGRDPWPGIVGFEATVIPQLERALIAGHDVVMLGERGQGKTRILRT
LVGLLDEWTPVIAGSELGEHPYEPITPGSIRKAANLLDDLPIEWRHRSQRYSEKLATPDT
SVADLVGDIDPMKVAEGRSLGDPETIHFGLIPRSHRGIVAINELPDLAERIQVSMLNVME
ERDIQVRGYTLRLPLDVLVMASANPEDYTNRGRIITPLKDRFGAEIRTHYPLELDDEVSV
IEQEADLTASVPTFITEILARFTRYARDHPSIDQRSGVSARFSIAGAETVAAAALHRATV
TGEDQAVARVVDLESVIEVLRGKIEFESGEEGRELEILEHLMRKSIADAVRAHLGGIDMA
PLVDALENGEPVVTGDRVRAADLLGSIPSPDATAGVLDQIAERLEADTEGERASAVELAL
EGLFLARRIGKEADESGQTVYG
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgacgagatccgcaacaacctcctgtccgcactccgcgagggacgtgatccgtgg
ccgggcatcgtgggcttcgaggccacggtcatcccgcagctcgagcgggcgctgatcgcc
ggccacgacgtcgtcatgctcggggaacgcggtcagggcaagacgcgaatcctgcgcacc
ctggtcgggctcctcgacgagtggacgccggtcatcgccggttccgaactcggtgagcac
ccgtacgaacccatcaccccggggtcgatccggaaggccgccaacctcctcgacgatctg
ccgatcgagtggcggcaccgttcgcagcgttacagcgagaagctggccacgccggacacg
tccgtcgccgacctcgtcggcgacatcgacccgatgaaggtcgccgagggccgcagcctc
ggcgacccggagaccatccacttcggactcatcccgcgttcgcaccgcggcatcgtcgcc
atcaacgagctgcccgacctcgccgagcgaatccaggtgtccatgctcaacgtgatggag
gagcgcgacatccaggtccgcggttacaccctgcgactgccgctcgacgtcctggtgatg
gcgagcgccaacccggaggactacaccaaccgcggacggatcatcaccccgctcaaggac
cgcttcggcgccgagatccgcacccattacccactcgagctcgacgacgaggtgtcggtc
atcgagcaggaggcggatctcaccgccagcgtgccgacgttcatcaccgagatcctggcg
cgcttcacccgttacgcccgcgatcacccgtccatcgaccagcggtccggtgtgtcggcc
cgcttctccatcgccggtgccgagaccgtcgcggccgcggcgctccaccgggcgacggtg
acgggcgaggatcaggcggtggcccgagtggtcgatctcgagtcggtgatcgaggtgctc
cgcggcaagatcgagttcgagtccggcgaggaggggcgtgaactggagatcctcgagcac
ctgatgcgcaagtccatcgccgacgcggtgcgtgcccacctcggtggcatcgacatggct
ccgctcgtcgatgccctcgagaacggtgagccggtggtcaccggtgaccgggtgcgcgcc
gccgatctgctgggttccatcccgtcgccggacgccaccgccggcgtcctcgaccagatc
gccgagcgcctcgaggccgacaccgaaggggagcgcgccagtgccgtcgaactcgcgctc
gaagggctcttcctcgcccgccggatcggcaaggaagccgacgagagcggtcaaacggtc
tacggctga

DBGET integrated database retrieval system