KEGG   Gordonia sp. KTR9: KTR9_1327Help
Entry
KTR9_1327         CDS       T02216                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
gor  Gordonia sp. KTR9
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:gor00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:gor00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:gor00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:gor00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1511488..1512432
Genome map
AA seq 314 aa AA seqDB search
MSATDKSGFSEYDGVPNTPPIPRTAVVPAAGLGTRFLPATKTVPKELLPVVDTPGIELVA
EEAKAAGADRLLIVTSPGKDGVVAHFVEDLVLENTLATRGKESMLAKVRKAPNLLEVASV
VQEKPLGLGHAVGCVESYLDDDEDAIAVLLPDDLVLPGGVLEVMARTRQRRGGSVLCAIE
VPEERISAYGVFDVEPLPDANNPNVMRLKGMVEKPEPEDAPSNLAAAGRYILDRKIFDAL
RRIEPGAGGELQLTDAIALLIEEGEPVHVVVHHGTRHDLGNPGGYLKAAVDFALDRDDYG
PDLREWLEKRLADS
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcgacggataaatctggtttcagtgagtacgacggtgtacccaacactccgccg
atcccgcgtaccgcggtcgttccggcagccgggttgggcacgaggttcctgccggcgacc
aagacggttcccaaagagctgttgccggtcgtcgacacccccggcatcgagctcgtcgcc
gaagaggccaaggcggccggcgccgaccgtctgctcatcgtgacctcgccgggcaaggac
ggtgtggtcgcccacttcgtcgaggacctcgtcctggagaacacgctcgccacgcgcggc
aaggagtcgatgctcgcgaaggtgcgcaaggcgccgaacctgctcgaagtcgcctcggtc
gtgcaggagaagccgctcggcctgggacacgcggtgggttgcgtcgagagctatctcgac
gacgacgaggacgcgatcgcggtcctgctgcccgacgacctggtgctccccggcggcgtc
ctcgaggtcatggcccgcacacgtcagcgccggggtgggtcggtgctgtgtgccatcgag
gtccccgaggagcggatcagcgcctacggcgtcttcgacgtcgagccgctgcccgatgcc
aacaaccccaacgtcatgcgcctcaagggcatggtcgagaagcctgaacccgaggacgcg
ccgtcgaacctcgccgctgcgggccgctacatcctggaccgcaagatcttcgacgcgctg
cggcgtatcgaacccggggccggcggtgaactccagctcaccgacgccatcgcgcttctc
atcgaggagggcgagccggttcacgtcgtcgtccaccacggcacccggcacgatctcggc
aaccccggcggttacctgaaggctgcggtcgacttcgcgctcgatcgcgacgattacggt
cccgatctgcgcgagtggctcgagaagcgcctcgccgacagctga

DBGET integrated database retrieval system