KEGG   Gordonia sp. KTR9: KTR9_1431Help
Entry
KTR9_1431         CDS       T02216                                 

Definition
4-diphosphocytidyl-2C-methyl-D-erythritol 2-phosphate synthase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
gor  Gordonia sp. KTR9
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:gor00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KTR9_1431
Enzymes [BR:gor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     KTR9_1431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1621963..1622928
Genome map
AA seq 321 aa AA seqDB search
MSRTSLSVVSDSVTARAPSKVNLHLGVGPRREDGYHDLVTVFQALSLHDDIRVARANETT
VTVRGEGAGSVPADESNLAVRAALALADWADRSGKVAIDIDKTIPVAGGMAGGSADAAGA
LVALAALWKLDIGRDDLATIAAGLGSDVPFALHGNTALGTGRGERLMQVLSRGEFHWVLA
LAREGLSTPAVYRELDRLRGSRSGECADDDERDLLRRPDELMQALASGDPRAVAPLLHND
LQPAALSLQPTLRRTLRAGIDAGALGGIVSGSGPTCAFLCADETSAVNVAAELSGAGVAR
SVRTASGPAAGTRVLGADLRR
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgcgtacgtcgctgtcggtggtgtcggactccgtcaccgcacgggctccgtcgaag
gtcaatctgcacctcggggtcggtccgcgccgcgaggacgggtaccacgacctggtcacc
gtcttccaggcgctgtccctgcacgacgacatccgggtggcccgtgcgaacgagacgacc
gtgaccgtccgcggtgaaggcgccgggtcggtcccggccgacgagtccaatctcgcggta
cgcgcggcgttggcactggccgactgggcggaccggtccggcaaggtcgccatcgacatc
gacaagacgatcccggtcgccggcggcatggccggtggcagcgccgacgccgcgggggcg
ctcgtcgcactcgccgccctctggaaactcgacatcggccgggacgacctcgccacgatc
gcggcgggtctgggcagcgacgtcccgttcgcgttgcacggcaacaccgcgctcggcacc
gggcgcggcgagcggttgatgcaggtcctctcccgcggggaattccactgggtcctggca
ctcgcgcgcgaagggctgtccacgccggcggtgtaccgcgaactggatcggttgcgcggc
agccgttctggcgagtgcgccgacgacgacgaacgcgacctgctccgacgccccgacgaa
ctgatgcaggcgctggcgtcgggcgacccgcgcgcggtggcgccgctgctgcacaacgat
ctacagcccgcggcgctctcattgcagccgacgctccgccggacgctgcgcgccgggatc
gacgccggagcgctgggcggcatcgtgtcggggtcgggtccgacgtgcgccttcctgtgc
gccgacgagaccagcgcggtgaacgtcgcggcggaattgtccggcgccggagttgctcgc
tcggtccgcaccgccagcggtccggctgccgggacgcgagtcctgggagccgatctccgg
cgctga

DBGET integrated database retrieval system