KEGG   Gordonia sp. KTR9: KTR9_1457Help
Entry
KTR9_1457         CDS       T02216                                 

Definition
Limonene-1,2-epoxide hydrolase
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
gor  Gordonia sp. KTR9
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gor00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    KTR9_1457
Enzymes [BR:gor01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     KTR9_1457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1652593..1653039
Genome map
AA seq 148 aa AA seqDB search
MTPQTPIEIVTTLLTEFARGDVPAALETIDDDIAYTNVSLPTIRGKRKVAGVLGGVARKD
SVGFNYRMINVSSDDTGVVLTERVDELRLGRLHLQFWVCGRFEVREGRITVWRDYFDYFD
MTKALVRGVAALAVPSVQRPLPAPAVPA
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaccccacagacgccgatcgagatcgtgacgaccctgctgaccgagttcgcgcggggc
gacgtacccgccgcgctggagaccatcgacgacgacatcgcctacacgaacgtctcgctg
ccgacgatccgcgggaaacggaaggtggccggagtcctgggcggagtggcacgcaaggac
tcggtgggattcaactaccggatgatcaacgtgagctctgacgacaccggcgtcgtgttg
accgagcgggtcgacgaactccgactcggccggctgcatctccagttctgggtgtgcggc
cgcttcgaggtgcgggagggccggatcacggtgtggcgcgactacttcgactatttcgac
atgacgaaggcgctggtgcgaggtgtggccgcgctggccgtgccgtcggtgcagcggcca
ctgcccgcgccggccgtcccggcctga

DBGET integrated database retrieval system