KEGG   Gordonia sp. KTR9: KTR9_1614Help
Entry
KTR9_1614         CDS       T02216                                 

Definition
Phosphodiesterase / alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
gor  Gordonia sp. KTR9
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:gor00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    KTR9_1614
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    KTR9_1614
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    KTR9_1614
Enzymes [BR:gor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     KTR9_1614
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1825934..1827235)
Genome map
AA seq 433 aa AA seqDB search
MTRIVRRGTVHATPEWGHSVHVDVRGLAPAADHFYRFRALGEISTVGRTRTAPAPSAHVD
TLTLAVATCQNWADGYYQAYADLAAHAPDVVLHLGDYIYEKPIPAQGGARTTAALPLSST
REAVDLDDYRERYALYKSDPDLQLAHAMAPFVITFDDHEVDNNWAAAVPEDDTPPVPFAL
RRARALRAWWENSPVRVTARPNGTVVRAHRRLGFGDLVDLTLLDTRSHRSDQANGDNDTG
QNQHTADPSRTILGAEQERWLLDGFASSRHRWDVLAQQVPMADLARTVGSTRAVSMDGWS
GYEASRARILDGATDRGVRNLVSLAGDIHRSVVADLRTSYTDDSAVRGVELAATSITSGG
DGEDSDDGDRRLKEASPHVRFGNSQRGYLLNRIHSDRWEAEFRVTPSVRSPRGTLHRRAL
ITIPDSTAEVDVV
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgacccggatcgtgcgtcggggaaccgtccacgcgacaccggagtggggacacagcgtg
catgtcgacgtccgcggactcgcgccggccgccgatcatttctatcggtttcgagcactc
ggtgagatctccaccgtcggacgaacccgcacggcaccagcaccttccgcacacgtcgac
acactcacgctggccgtggcgacctgccagaactgggccgacggctactaccaggcctac
gccgacctggccgcacatgcgcccgatgtggtcctccacctcggcgactacatttacgag
aagccgatccccgcgcagggcggcgcgagaaccactgccgcgcttcctctttcgtcgacc
cgggaggctgtcgacctcgacgactaccgggaacggtacgcgctgtacaaatccgacccg
gacctgcaactcgctcacgcgatggcgccgttcgtgatcaccttcgacgatcacgaggtg
gacaacaactgggccgcagcggttcccgaggacgacacaccgcctgtcccgttcgcgctg
cgccgggcacgcgccctgcgcgcgtggtgggagaacagcccggtccgggtcacggcccgg
ccgaacggaaccgtggtgcgcgcgcaccggcggctgggtttcggcgacctcgtcgacctc
actctcctcgacacccgtagtcaccgcagcgatcaggccaacggggacaacgacaccggg
cagaaccagcacaccgcggacccgtcccgcacgatcctcggcgccgagcaggaaagatgg
ttgctcgacggcttcgcgtcctcacggcaccgctgggacgtgctcgcccagcaggtgccg
atggccgacctcgcccggaccgtcggctcgacccgtgcggtcagcatggacggctggagc
ggctacgaggcgtctcgcgcccggatactcgacggcgccaccgaccgcggcgtgcgcaac
ctggtgtccctcgccggtgacatccaccgcagcgtggtcgccgacctccggacctcgtac
accgatgactcagcggtgcgcggagtcgaactcgccgcgacgtcgatcacctcgggcggc
gacggggaggacagcgacgacggcgaccgccggctgaaggaggcctcaccccacgtccgg
ttcggcaactcacagcgcggatacctgctcaaccggatccactccgaccggtgggaggcc
gagttccgcgtgacgccgtccgtgcggtcgccccggggaacgctgcaccgtcgagcgctc
atcacgatccccgactcgaccgccgaagtcgacgtcgtgtga

DBGET integrated database retrieval system