KEGG   Gordonia sp. KTR9: KTR9_1709Help
Entry
KTR9_1709         CDS       T02216                                 

Definition
(GenBank) Succinate dehydrogenase, hydrophobic anchor subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
gor  Gordonia sp. KTR9
Pathway
gor00020  Citrate cycle (TCA cycle)
gor00190  Oxidative phosphorylation
gor00650  Butanoate metabolism
gor01100  Metabolic pathways
gor01110  Biosynthesis of secondary metabolites
gor01120  Microbial metabolism in diverse environments
gor01130  Biosynthesis of antibiotics
gor01200  Carbon metabolism
Module
gor_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:gor00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KTR9_1709
   00650 Butanoate metabolism
    KTR9_1709
  Energy metabolism
   00190 Oxidative phosphorylation
    KTR9_1709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Cation_ATPase_C CybS
Motif
Other DBs
NCBI-ProteinID: AFR48348
UniProt: J9SFD7
Position
complement(1936245..1936700)
Genome map
AA seq 151 aa AA seqDB search
MTTSEATGVAKTLGTQHDRPASLDNPRSPRKPKGGNFEKNAWLFMRFSGLLLVVLTIGHM
FIMLAWDGGVHRIDASFVAARWSSPFWQIWDLTMLWLAQLHGGNGVRTVIADYSRKDSTR
FWLNVLLAVSMILVLTMGTYALLTFDVNSVG
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgaccacctcggaagccaccggtgtcgccaagaccctcggcacgcaacacgaccgtccc
gcgagcctggacaacccgcgctcgccccgcaagcccaagggcggcaacttcgagaagaac
gcatggctgttcatgcggttctcgggtctgctgctcgtcgtcctgacgatcggccacatg
ttcatcatgctggcctgggacggcggcgtgcaccgcatcgacgcctcgttcgtcgccgca
cgctggagctcacccttctggcagatctgggacctcaccatgctgtggctggcccagctg
cacggcggcaacggtgtgcgcaccgtcatcgccgactactcccgcaaggactcgacccgt
ttctggctgaacgtgctgctcgccgtgtcgatgatcctcgtcctcacgatgggcacctac
gccctcctgaccttcgacgtcaacagcgtcggctag

DBGET integrated database retrieval system