KEGG   Gordonia sp. KTR9: KTR9_1709Help
Entry
KTR9_1709         CDS       T02216                                 

Definition
Succinate dehydrogenase, hydrophobic anchor subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
gor  Gordonia sp. KTR9
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:gor00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KTR9_1709
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KTR9_1709
   00650 Butanoate metabolism
    KTR9_1709
  Energy metabolism
   00190 Oxidative phosphorylation
    KTR9_1709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1936245..1936700)
Genome map
AA seq 151 aa AA seqDB search
MTTSEATGVAKTLGTQHDRPASLDNPRSPRKPKGGNFEKNAWLFMRFSGLLLVVLTIGHM
FIMLAWDGGVHRIDASFVAARWSSPFWQIWDLTMLWLAQLHGGNGVRTVIADYSRKDSTR
FWLNVLLAVSMILVLTMGTYALLTFDVNSVG
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgaccacctcggaagccaccggtgtcgccaagaccctcggcacgcaacacgaccgtccc
gcgagcctggacaacccgcgctcgccccgcaagcccaagggcggcaacttcgagaagaac
gcatggctgttcatgcggttctcgggtctgctgctcgtcgtcctgacgatcggccacatg
ttcatcatgctggcctgggacggcggcgtgcaccgcatcgacgcctcgttcgtcgccgca
cgctggagctcacccttctggcagatctgggacctcaccatgctgtggctggcccagctg
cacggcggcaacggtgtgcgcaccgtcatcgccgactactcccgcaaggactcgacccgt
ttctggctgaacgtgctgctcgccgtgtcgatgatcctcgtcctcacgatgggcacctac
gccctcctgaccttcgacgtcaacagcgtcggctag

DBGET integrated database retrieval system