KEGG   Gordonia sp. KTR9: KTR9_1712Help
Entry
KTR9_1712         CDS       T02216                                 

Definition
Thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
gor  Gordonia sp. KTR9
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gor00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    KTR9_1712
Enzymes [BR:gor01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     KTR9_1712
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1937776..1939080
Genome map
AA seq 434 aa AA seqDB search
MSVIATKRGGHELSDAQIAWMVDGYTRGEVAPEQMSALLMAVYLRGMDRREIASWTHAMI
DSGRRMDLSGLRRNGKTLATVDKHSTGGVGDKITLPLTPLVASFGVAVPQLSGRGLGHTG
GTLDKLESIPGWRAEVSTAEMLDQLERVGAVICAAGADLAPADRKLYALRDVTGTVESIP
LLASSIMSKKIAEGTGALVLDVKTGSGAFLPEESDARELASTMVELGHDAGVDTRAVITD
MSTPLGLAVGNAVEVAESVEVLAGGGPADVVELTLALAREMLDAAGLVDADPATHLADGR
AMDTWRAMIAAQGGDPDAPLPQARHHDTVTAARDGVVTQMDARAVGDAAWRLGGGRSKPG
EAVAAEAGVIIHAKPGDRVRAGQPLFTLHTQDEGRIAGARSCLPGAATVEPDAPGHAVGA
GTRPLIIDRVRFTP
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
gtgtcggtcatcgccacaaagcggggcggacacgaactcagcgacgcgcagatcgcgtgg
atggtcgacggttacacccgtggcgaggtggcgccggaacagatgtcggcactgctgatg
gcggtgtacctgcgcggtatggatcgccgggagatcgcgtcctggacgcacgcgatgatc
gacagcgggcggcggatggatctgtccggtctgcggcggaacgggaagacgctcgcgacc
gtcgacaagcactcgaccggcggcgtcggtgacaagatcaccctcccgctcacaccgctg
gtcgcatccttcggtgtcgccgtgccgcagctgtccggccgggggctcggtcacaccggc
ggcacgttggacaagctggagtccattccgggatggcgggccgaggtgagcacggccgag
atgctcgaccaactcgaacgcgtcggcgcggtcatctgcgccgcgggtgccgacctggcg
ccggccgaccgcaagctctacgcactgcgcgacgtcaccggaacggtcgaatccattccg
ctgctggcctcgtcgatcatgagcaagaagatcgccgaggggaccggtgcgctggtcctc
gatgtcaagaccggatcgggtgccttcctgcccgaagagagcgacgcgcgcgaactcgcg
tcgacgatggtcgaactcggtcacgacgccggggtcgacacccgcgccgtgatcaccgac
atgagcacaccgctcggactcgcggtcggcaatgccgtcgaggtggccgagtcggtggag
gtcctcgcgggcggcgggcccgccgacgtcgtcgagctcaccctggccctggccagggag
atgctcgacgccgcggggctcgtcgacgccgatccggcaacccatctcgccgacggccgg
gcgatggacacctggcgggcgatgatcgccgcgcagggcggcgacccggacgcgccgcta
ccgcaggcgcgccatcacgacaccgtgaccgcggcgcgtgacggtgtcgtcacccagatg
gatgcgcgcgcggtgggcgacgccgcatggcgactcgggggtggcagatcgaaaccgggg
gaggcggtcgcggccgaggccggagtgatcatccatgcgaaaccgggggatcgtgtgcgg
gccggtcaaccgttgttcaccctgcacacgcaggatgagggccggatcgccggcgcgcgc
tcgtgtctgcccggggcggcgacggtcgagcccgacgcccctggacacgcggtcggcgcg
ggcacccgaccactgatcatcgaccgcgttaggttcactccatga

DBGET integrated database retrieval system