KEGG   Gordonia sp. KTR9: KTR9_1727Help
Entry
KTR9_1727         CDS       T02216                                 

Definition
Glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
gor  Gordonia sp. KTR9
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gor00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    KTR9_1727
Enzymes [BR:gor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     KTR9_1727
Exosome [BR:gor04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KTR9_1727
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1953262..1954749)
Genome map
AA seq 495 aa AA seqDB search
MAAIDQGTTSTRAMIFDHKGHVVGVEQLEHEQIFPRAGWVEHDAAEIWRNTRRVGAAALA
SAELTAKDIVACGLTNQRETTVIWERDTGKPVHNAIVWQDTRTDDLCTELAGDVGMDRYR
DRTGLPLSTYFAGPKARWLLDSVDGLRERAENGELCFGTMDSWIAWNMTGGVDGGRHVTD
VTNASRTMLMDLRTQQWDPEICAEMGIPMAMLPEIRSSSGDFGALRGNGPLPGVPLSGIL
GDQQAATFGQACLEPGEAKNTYGTGNFLLLNTGTEPVFSEHGLLTTVCYRIGDQPARYAL
EGSIAVTGSLIQWLRDNLGLISQASDVEGLAAGVDDNGGAYFVPAFSGLFAPRWRPDARG
VIVGLTRFVDKGHIARAALEASAFQTREVIEAMQADSGVELSTLKVDGGMVVNELLMQFQ
ADILDVPVVRPVVNETTALGAAYAAGLAVGFWESEDEIRANWAEDKRWEPGMEAAERDRL
YAGWNRAVEHSFGLT
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtggcggcgatcgaccagggcaccacctcgacccgggcgatgatcttcgaccacaaaggg
cacgtcgtcggcgtcgaacagctcgagcacgaacagatcttcccgcgcgcgggctgggtg
gagcacgatgccgccgagatctggcgcaacacgcgccgggtcggggccgctgccctcgca
tcggccgagctgaccgccaaggacatcgtcgcgtgcggcctcaccaaccagcgcgagacc
accgtgatctgggagcgcgacaccggcaagccggtgcacaacgccatcgtctggcaggac
acgcggaccgacgacctgtgcaccgaactcgccggcgacgtcggcatggaccgctatcgc
gatcgcaccggcctgccgctgtcgacctacttcgccggcccgaaggcccggtggctcctc
gattccgtcgacggcctccgcgagcgcgccgagaacggggaattgtgtttcggcacaatg
gattcctggattgcatggaacatgaccggcggcgtggacggtggccggcacgtcacagac
gtcaccaatgcctcacgcacgatgctcatggatctgcggacccagcagtgggaccccgag
atctgcgccgagatgggcatcccgatggccatgctgcccgagatcaggagctcctcaggc
gatttcggcgctctccgcggcaacggccccctccccggcgtaccgctgtcgggcatcctc
ggagaccagcaggccgcgacattcggccaggcctgcctggaacccggcgaggcgaagaac
acctatggcaccgggaacttcctgctcctcaacaccggcaccgagcccgtcttcagcgag
cacgggctgctcaccaccgtctgctaccggatcggcgatcagcccgcgcgatacgcactc
gagggttcgatcgcggtgaccggttcgctcatccagtggctgcgcgacaatctcggcctg
atctcgcaggcgtccgacgtcgagggactggccgccggggtcgacgacaacggtggtgcc
tacttcgtgccggcgttctccggactcttcgcaccgcgctggcggcccgacgcccgcggc
gtcatcgtgggtctcacccgcttcgtcgacaaaggtcacatcgcgcgggcagcgttggag
gccagcgcttttcagacccgggaggtcatcgaggcgatgcaggccgactccggggtggaa
ctgtcgacactgaaggtcgacggcgggatggtcgtcaacgaactgctcatgcagttccag
gccgacatcctggatgtcccggtcgtgcgcccggtcgtcaacgagacgaccgcgctcggg
gcggcctacgcggccggcctggcggtgggcttctgggagagcgaggacgagatccgcgcc
aactgggccgaggacaagcggtgggagccggggatggaggcagccgaacgcgaccgcctc
tacgcggggtggaaccgggcggtcgagcacagcttcggcctgacctga

  All links  
No link information was found.   
DBGET integrated database retrieval system