KEGG   Gordonia sp. KTR9: KTR9_1849Help
Entry
KTR9_1849         CDS       T02216                                 

Definition
Threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
gor  Gordonia sp. KTR9
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:gor00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KTR9_1849
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KTR9_1849
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    KTR9_1849
Enzymes [BR:gor01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     KTR9_1849
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2094922..2096007
Genome map
AA seq 361 aa AA seqDB search
MTEATSTPVHRAWPGLIEAYRSRLPVGDDWKVVTLLEGGTPLISAPHLSSLTGCEVYLKV
EGLNPTGSFKDRGMTMAVSNAVNNGKTAVLCASTGNTSASAAAYATRAGITCAVLIPQGK
IAMGKLAQAVMHGAKIIQVEGNFDDCLELARKATSEFTEIELVNSVNPARIEGQKTAAFE
IVDVLGRAPDVHALPVGNAGNITAYWKGYTEYHADGVSSSVPRMLGVQAAGAAPLVNGAP
VKDPETIATAIRIGSPASWNQAVAAKEESHGQFRAATDEKLLEAYRLVAGKEGVFVEPAS
AASVAGLLAASADGWIEPGSTVVCTVTGNGLKDPDTALAGIPEVEAIPVDPVAVANALGV
G
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagcgacttctacgcccgtccaccgcgcgtggcccggcctgatcgaggcatac
cggtcgcggctgcctgtcggcgacgactggaaggtcgtcacgctgctcgagggcggcacc
ccgctgatcagcgcgccgcacctgtcgtcgctgaccgggtgcgaggtgtacctgaaggtc
gagggcctcaacccgaccggttcgttcaaggaccgcgggatgacgatggccgtcagcaat
gcggtcaacaacggcaagaccgcggtcctgtgcgcctcgaccggcaacacctcggcgtcg
gccgccgcctacgccacccgggccggcatcacctgcgcggtgctgatcccgcagggcaag
atcgcgatgggcaagctcgcgcaggcggtcatgcacggcgccaagatcatccaggtcgag
ggcaacttcgacgactgcctcgagctcgcgcgcaaggccacctccgagttcaccgagatc
gagctcgtcaattcggtgaatccggcgcggatcgagggccagaagaccgccgcgttcgag
atcgtcgacgtcctgggccgcgcccccgacgtccacgcgctgccggtcgggaacgcgggc
aacatcaccgcgtactggaagggttacaccgaataccacgcggacggcgtctcgtcgtcg
gtgccgcgcatgctcggggtgcaggccgcgggcgccgcgccgctggtgaacggtgcgccg
gtgaaggacccggagaccatcgccaccgccatccgcatcgggtccccggccagctggaac
caggccgtcgcggcgaaagaggagtcgcacggccagttccgcgcggccaccgacgagaag
ctgctcgaggcctaccgccttgtcgcaggcaaggagggcgtgttcgtcgagccggcctcg
gctgccagcgtcgcgggtctgctcgcggccagcgccgatggctggatcgagccgggatcg
accgtggtgtgcacggtgaccggcaacggcctgaaggaccccgacaccgccctggcgggc
atcccggaggtcgaggccattccggtggatccggtggcggtcgcgaatgctctcggtgtc
ggctga

DBGET integrated database retrieval system