KEGG   Gordonia sp. KTR9: KTR9_1849Help
Entry
KTR9_1849         CDS       T02216                                 

Definition
(RefSeq) Threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
gor  Gordonia sp. KTR9
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:gor00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KTR9_1849
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KTR9_1849
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    KTR9_1849
Enzymes [BR:gor01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     KTR9_1849
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2094922..2096007
Genome map
AA seq 361 aa AA seqDB search
MTEATSTPVHRAWPGLIEAYRSRLPVGDDWKVVTLLEGGTPLISAPHLSSLTGCEVYLKV
EGLNPTGSFKDRGMTMAVSNAVNNGKTAVLCASTGNTSASAAAYATRAGITCAVLIPQGK
IAMGKLAQAVMHGAKIIQVEGNFDDCLELARKATSEFTEIELVNSVNPARIEGQKTAAFE
IVDVLGRAPDVHALPVGNAGNITAYWKGYTEYHADGVSSSVPRMLGVQAAGAAPLVNGAP
VKDPETIATAIRIGSPASWNQAVAAKEESHGQFRAATDEKLLEAYRLVAGKEGVFVEPAS
AASVAGLLAASADGWIEPGSTVVCTVTGNGLKDPDTALAGIPEVEAIPVDPVAVANALGV
G
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagcgacttctacgcccgtccaccgcgcgtggcccggcctgatcgaggcatac
cggtcgcggctgcctgtcggcgacgactggaaggtcgtcacgctgctcgagggcggcacc
ccgctgatcagcgcgccgcacctgtcgtcgctgaccgggtgcgaggtgtacctgaaggtc
gagggcctcaacccgaccggttcgttcaaggaccgcgggatgacgatggccgtcagcaat
gcggtcaacaacggcaagaccgcggtcctgtgcgcctcgaccggcaacacctcggcgtcg
gccgccgcctacgccacccgggccggcatcacctgcgcggtgctgatcccgcagggcaag
atcgcgatgggcaagctcgcgcaggcggtcatgcacggcgccaagatcatccaggtcgag
ggcaacttcgacgactgcctcgagctcgcgcgcaaggccacctccgagttcaccgagatc
gagctcgtcaattcggtgaatccggcgcggatcgagggccagaagaccgccgcgttcgag
atcgtcgacgtcctgggccgcgcccccgacgtccacgcgctgccggtcgggaacgcgggc
aacatcaccgcgtactggaagggttacaccgaataccacgcggacggcgtctcgtcgtcg
gtgccgcgcatgctcggggtgcaggccgcgggcgccgcgccgctggtgaacggtgcgccg
gtgaaggacccggagaccatcgccaccgccatccgcatcgggtccccggccagctggaac
caggccgtcgcggcgaaagaggagtcgcacggccagttccgcgcggccaccgacgagaag
ctgctcgaggcctaccgccttgtcgcaggcaaggagggcgtgttcgtcgagccggcctcg
gctgccagcgtcgcgggtctgctcgcggccagcgccgatggctggatcgagccgggatcg
accgtggtgtgcacggtgaccggcaacggcctgaaggaccccgacaccgccctggcgggc
atcccggaggtcgaggccattccggtggatccggtggcggtcgcgaatgctctcggtgtc
ggctga

DBGET integrated database retrieval system