KEGG   Gordonia sp. KTR9: KTR9_1871Help
Entry
KTR9_1871         CDS       T02216                                 

Definition
UDP-N-acetylglucosamine enolpyruvyl transferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
gor  Gordonia sp. KTR9
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gor00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    KTR9_1871
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    KTR9_1871
Enzymes [BR:gor01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     KTR9_1871
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2117475..2118731
Genome map
AA seq 418 aa AA seqDB search
MSDRFLVSGGARLSGEVAVGGAKNSVLKLMAAALLAEGTTVLTNAPEIADVPLMADVLRG
LGAVVDMDGETVSITAPAEPKFHADFAAVRQFRASVCVLGPLMARCHRAVVALPGGDAIG
SRPLDMHQAGLRALGATSSIEHGCVVAEADRLIGAPIALEFPSVGATENILMAAVLAEGQ
TTIDNAAREPEIVDLCVMLQQMGARIDGAGTSTLTVVGVDRLQPTTHRVVGDRIVGATWG
IAAAMTRGDVTVRGVKPQHLQLVLNKLVDTGAVVDTFDDGFRVRHDRRPTAVNVSTLPFP
GFPTDLQPMAIGLASISDGMSVITENVFEARFRFVEEMIRLGADARTDGHHAVIRGIDRL
SSAPVWCSDIRAGAGLVLAGLVADGVTEVHDVEHIDRGYPHFVEILRSLGGEIERVRD
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgatcggtttctggtgtccgggggagcgcgtctgtccggcgaggtggcagtgggc
ggcgcgaagaacagcgtcctgaaactgatggccgccgcactcctcgccgaggggacgacc
gtgctgaccaacgcacccgagatcgccgacgtcccgttgatggccgacgtactccgcggt
ctgggtgcggtcgtcgacatggacggcgagacggtgtcgatcaccgcccccgcggagccg
aagttccacgccgacttcgcggccgtccggcagttccgcgcctcggtctgcgttctcggt
ccgctgatggcgcgctgccatcgagccgtcgtcgcgctgcccggcggcgacgcgatcggg
tcgcggccactcgacatgcaccaggcgggtctgcgcgcgctgggtgccaccagctccatc
gaacacggttgtgtggtcgccgaagccgacaggctgatcggcgcaccgatcgcgttggag
ttcccctcggtgggggcgaccgagaacatcctgatggcggccgtgctggccgaggggcag
accaccatcgacaacgccgcgcgcgagccggagatcgtcgacctctgcgtgatgctgcaa
cagatgggcgcacggatcgacggagccggaacgtcgacgctgaccgtggtcggcgtcgac
cggttgcagccgaccacccatcgggtcgtcggggaccgcatcgtcggggccacctggggg
atcgcggccgcgatgacccgcggtgacgtgaccgtccggggcgtgaaaccccaacacctg
caactggtcctgaacaaactggtggacaccggagccgtggtcgacaccttcgacgacggc
ttccgggtccggcacgaccgtcgtccgaccgccgtcaacgtctccacgctgccgttcccc
ggctttcccaccgatctgcagccgatggccatcggtctcgcgtccatctccgacggcatg
tcggtcatcaccgagaacgtcttcgaggcccggttccgcttcgtcgaggagatgatccgt
ctgggtgccgacgcgcggaccgacggtcaccacgcggtcatccgcgggatcgaccgcctc
tcgagcgcgccggtctggtgctcggacatccgcgcgggagccggcctcgtactggccgga
ctcgtcgccgacggcgtgaccgaggtgcacgacgtcgagcacatcgaccggggctatccg
catttcgtggagatcctgcgcagtctcgggggcgagatcgagcgcgtgcgcgactga

DBGET integrated database retrieval system