KEGG   Gordonia sp. KTR9: KTR9_1881Help
Entry
KTR9_1881         CDS       T02216                                 

Definition
(GenBank) Glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
gor  Gordonia sp. KTR9
Pathway
gor00220  Arginine biosynthesis
gor00250  Alanine, aspartate and glutamate metabolism
gor00471  D-Glutamine and D-glutamate metabolism
gor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gor00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KTR9_1881
   00220 Arginine biosynthesis
    KTR9_1881
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    KTR9_1881
Enzymes [BR:gor01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     KTR9_1881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase STAS STAS_2
Motif
Other DBs
NCBI-ProteinID: AFR48520
UniProt: J9S649
Position
2134177..2135610
Genome map
AA seq 477 aa AA seqDB search
MRSLVDGYLSHIMDECHSDRSGHVADYIPELAAVDPEGYGLSLCVHDGHTYSQGDSATSF
TIQSVSKPLTYAMILKKHGTAAVDAKIGVEPSGEAFNEISVDDRRRPKNPMINAGAIFAA
SMLLPPTRDVDDAAVDAAFREVLEFYSGCAGRHLVMDEEVYASEAATGSRNRAIAYMLDS
FGALETSPDAALDLYYRQCSIRVTTDDLAGIGATIGNGGMNPRTGRTVFSNETAQRLLSV
MTTCGMYDGAGDWVTSVGLPAKSGVGGGILAVLPGQLGIGVYSPRLDAHGNSVRGVDVCR
HLSTDLGLHMFNVTRESRVTIRSVYDLADTPVSAEWGEQERSYLRTCRDRIRVYELQGDL
TFAGAESVQRRLEADLDDYTVVIVEISRIGVIDAVARTMVLSIKRLLDDSGRRAALVDPD
GVVRSSVDRHRNDAAVPDLDAPPELQGFDPALPHVHSTMDDAVIDAETFLLKHYYDQ
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgcgatccctcgtcgacggatacctcagccacatcatggacgaatgccactcggatcgg
tccgggcacgtcgccgactacatccccgaactcgccgcggtcgaccccgagggctacgga
ctgtcgctgtgcgtgcacgacgggcacacctactcgcagggtgattccgcgacgtcgttc
acgatccagtcggtctccaaacccctcacctacgcgatgatcctgaagaagcacggcacc
gcggcggtcgacgcgaagatcggcgtggagccgtcgggggaggcgttcaacgagatcagc
gtcgacgaccgtcgccgccccaagaatccgatgatcaacgccggggccatcttcgccgcg
tcgatgctcctcccgccgacgcgggacgtcgacgacgccgcggtggacgccgccttccga
gaggtgctcgagttctactcgggatgtgccggccggcatctcgtcatggacgaggaggtc
tacgcctcagaggccgcgacgggttcgcgcaatcgagccatcgcttacatgctcgacagt
ttcggcgccctcgagaccagtccggacgcggcgctcgatctctactaccggcagtgctcg
atccgggtgacgaccgacgacctcgccgggatcggcgccaccatcgggaacggcgggatg
aatccccgtacgggccggacggtgttctccaatgaaaccgcgcagcggttgctgagcgtg
atgacgacgtgcggcatgtacgacggcgcgggtgactgggtcacctccgtcggactgccg
gccaagagcggcgtcgggggcggcatcctcgcggtgctcccgggccagctcggcatcggc
gtgtactcgccacggctcgacgcccacggcaacagcgtccgcggagtggatgtctgccgc
catctgtcgacagatctcgggctgcacatgttcaacgtgacacgagagagccgcgtgacc
atccgctcggtgtacgacctcgccgacacccccgtcagcgccgagtggggcgaacaggag
cgcagctaccttcggacgtgtcgcgaccggatccgcgtctacgaactgcagggtgacctg
accttcgcgggcgccgagagcgtgcagcgacgcctcgaagccgacctcgacgactacacc
gtggtcatcgtcgagatctcgcggatcggggtgatcgacgccgtcgcacgcaccatggtg
ctgagcatcaaacgactgctggacgacagcgggcggcgtgcggctctcgtcgaccccgac
ggcgtcgtccgttccagtgtcgaccggcaccgcaacgatgcggcggtgcccgatctcgat
gcgccgccggaactccagggcttcgatcctgcgcttccacatgtgcattcgacgatggac
gacgcggtcatcgacgccgagacgtttctgctgaagcactattacgaccagtga

DBGET integrated database retrieval system