KEGG   Gordonia sp. KTR9: KTR9_1881Help
Entry
KTR9_1881         CDS       T02216                                 

Definition
Glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
gor  Gordonia sp. KTR9
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:gor00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:gor00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:gor00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2134177..2135610
Genome map
AA seq 477 aa AA seqDB search
MRSLVDGYLSHIMDECHSDRSGHVADYIPELAAVDPEGYGLSLCVHDGHTYSQGDSATSF
TIQSVSKPLTYAMILKKHGTAAVDAKIGVEPSGEAFNEISVDDRRRPKNPMINAGAIFAA
SMLLPPTRDVDDAAVDAAFREVLEFYSGCAGRHLVMDEEVYASEAATGSRNRAIAYMLDS
FGALETSPDAALDLYYRQCSIRVTTDDLAGIGATIGNGGMNPRTGRTVFSNETAQRLLSV
MTTCGMYDGAGDWVTSVGLPAKSGVGGGILAVLPGQLGIGVYSPRLDAHGNSVRGVDVCR
HLSTDLGLHMFNVTRESRVTIRSVYDLADTPVSAEWGEQERSYLRTCRDRIRVYELQGDL
TFAGAESVQRRLEADLDDYTVVIVEISRIGVIDAVARTMVLSIKRLLDDSGRRAALVDPD
GVVRSSVDRHRNDAAVPDLDAPPELQGFDPALPHVHSTMDDAVIDAETFLLKHYYDQ
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgcgatccctcgtcgacggatacctcagccacatcatggacgaatgccactcggatcgg
tccgggcacgtcgccgactacatccccgaactcgccgcggtcgaccccgagggctacgga
ctgtcgctgtgcgtgcacgacgggcacacctactcgcagggtgattccgcgacgtcgttc
acgatccagtcggtctccaaacccctcacctacgcgatgatcctgaagaagcacggcacc
gcggcggtcgacgcgaagatcggcgtggagccgtcgggggaggcgttcaacgagatcagc
gtcgacgaccgtcgccgccccaagaatccgatgatcaacgccggggccatcttcgccgcg
tcgatgctcctcccgccgacgcgggacgtcgacgacgccgcggtggacgccgccttccga
gaggtgctcgagttctactcgggatgtgccggccggcatctcgtcatggacgaggaggtc
tacgcctcagaggccgcgacgggttcgcgcaatcgagccatcgcttacatgctcgacagt
ttcggcgccctcgagaccagtccggacgcggcgctcgatctctactaccggcagtgctcg
atccgggtgacgaccgacgacctcgccgggatcggcgccaccatcgggaacggcgggatg
aatccccgtacgggccggacggtgttctccaatgaaaccgcgcagcggttgctgagcgtg
atgacgacgtgcggcatgtacgacggcgcgggtgactgggtcacctccgtcggactgccg
gccaagagcggcgtcgggggcggcatcctcgcggtgctcccgggccagctcggcatcggc
gtgtactcgccacggctcgacgcccacggcaacagcgtccgcggagtggatgtctgccgc
catctgtcgacagatctcgggctgcacatgttcaacgtgacacgagagagccgcgtgacc
atccgctcggtgtacgacctcgccgacacccccgtcagcgccgagtggggcgaacaggag
cgcagctaccttcggacgtgtcgcgaccggatccgcgtctacgaactgcagggtgacctg
accttcgcgggcgccgagagcgtgcagcgacgcctcgaagccgacctcgacgactacacc
gtggtcatcgtcgagatctcgcggatcggggtgatcgacgccgtcgcacgcaccatggtg
ctgagcatcaaacgactgctggacgacagcgggcggcgtgcggctctcgtcgaccccgac
ggcgtcgtccgttccagtgtcgaccggcaccgcaacgatgcggcggtgcccgatctcgat
gcgccgccggaactccagggcttcgatcctgcgcttccacatgtgcattcgacgatggac
gacgcggtcatcgacgccgagacgtttctgctgaagcactattacgaccagtga

DBGET integrated database retrieval system