KEGG   Gordonia sp. KTR9: KTR9_1889Help
Entry
KTR9_1889         CDS       T02216                                 

Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
gor  Gordonia sp. KTR9
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:gor00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KTR9_1889
Enzymes [BR:gor01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     KTR9_1889
Exosome [BR:gor04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KTR9_1889
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2142069..2144291)
Genome map
AA seq 740 aa AA seqDB search
MTDHPDPPDLPDPSATDHDLRRLAAQTHPDPHAFLGAHDAPGGTTILRTLRPDATSVSAV
IGGVDHPMTRQTDDLWVVTVAMADLMDYRYRVVYPDPAGGTSEFVVADGYRFLPSLGEVD
IHLFSEGRHEALWNVLGAHVTSYTTTDGDVHGTAFSVWAPNAHGVTVIGDFDNWTGRVAP
MRKVGVSGVWEVFIPDVGDGTHYKFRVHGADGVIRDKADPMAFRTSTPPATASRVTVSEH
VWSDDAWIARRERSAPEREPMSVYEVHLASWRQGLGYRELAHELADYAVEKGFTHVEFLP
VAEHPFGGSWGYQVTSYYAPTARFGTPDDFRYLVDHLHSRDIAVIVDWVPAHFPKDDWAL
ARFDGTPLYEHADPMRGEQLDWGTYVFDFGRHEVRNFLVANALFWFGEFHIDGLRVDAVA
SMLYLDYSRPAGQWRPNVHGGRENLEAVQFLQETNATVHKHFPGVITVAEESTAWPGVTR
MTDLGGLGFSFKWNMGWMHDTLDYLSRDQVHRSFHHHEITFSLVYAWSENFVLPLSHDEV
VHGKGTLWTRMPGDSFAKAAGVRVYLAYMWSHPGKQLLFMGQEFGQTGEWADNRSLDWHQ
LEGWEGELHSGISALVTDLNRIYRSRPALYTQDIDPLGYEWIDANDTANNVISFLRYGTD
GSVVACLFNLSGSDRADYQIGLPSAGVWDEILNTDAAAYSGAGRGNMGSVSADGPSYHGR
PVSARVMLPANSAIWLVPRD
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgatcaccccgatccgccggacctgccggacccgagcgccaccgaccacgacctc
cgtcgcctggccgcgcagacccatcccgacccgcacgcctttctcggtgctcacgatgcg
cccggcggcaccacaatccttcgcacgttgcgcccggacgcgacgtcggtgtccgcggtc
atcggcggggtcgatcatccgatgacccgccagaccgacgacctgtgggtggtcaccgtt
gcgatggccgacctcatggactaccggtaccgcgtcgtctatcccgaccccgcgggcggc
acgtcggagttcgtcgtcgccgacggttatcggttcctgccgagtctgggcgaggtcgac
atccacctgttcagcgagggccgccacgaagcgctgtggaacgtcctgggcgcgcacgtg
acgtcgtacaccacgaccgacggcgacgtgcacggcaccgccttctccgtgtgggcaccg
aatgcccacggcgtcaccgtgatcggcgacttcgacaactggaccggacgggttgcgccg
atgcgcaaggtcggggtcagcggcgtgtgggaggtcttcatccccgacgtcggcgacggc
acccactacaaattccgcgtccacggcgccgacggcgtcatccgcgacaaggccgacccg
atggccttccgcaccagcaccccgccggcaaccgcctcgcgggtcaccgtctccgagcac
gtgtggtccgacgacgcctggatcgcgcgccgggaacggtccgctcccgagcgcgagccg
atgagcgtctacgaggtccaccttgcatcctggcggcagggcctcggctaccgcgaactc
gcgcacgagctggccgattacgccgtcgagaagggcttcacccacgtcgagttcctcccc
gtcgccgagcacccgttcggcggctcgtggggctaccaggtcacgtcctactacgcaccg
acggcccgcttcgggacccccgacgacttccgctacctcgtcgaccatctccactcgcgg
gacatcgccgtgatcgtcgactgggtcccggcccacttccccaaggacgattgggcgctg
gcccgtttcgacggcaccccgctgtacgagcacgccgacccgatgcgcggcgagcaactc
gactggggcacctacgtcttcgacttcggcaggcacgaggtccgcaacttcctggtcgcg
aacgccctgttctggttcggcgagttccacatcgacggcctccgcgtcgacgcggtggcc
tcgatgctctacctggactactcgcggccggccgggcagtggcgtcccaacgtccacggc
ggccgggagaacctggaggcggtgcagttcctccaggagacgaatgcgaccgtccacaaa
cactttccgggcgtgatcacggtcgccgaggagtcgaccgcgtggccgggtgtgacccgc
atgaccgatctcggcggactgggcttcagcttcaaatggaacatgggctggatgcacgac
accctcgactacctgtcacgcgaccaggtgcaccgcagcttccaccaccacgagatcacc
ttctcgctggtgtacgcgtggagcgagaacttcgtgctgcccctgtcccacgacgaggtc
gtgcacggcaagggcaccctgtggacgcggatgccaggcgattcgttcgccaaggccgcg
ggcgtgcgcgtctacctcgcctacatgtggtcccaccccggcaagcagctgctgttcatg
gggcaggagttcgggcagaccggcgaatgggccgacaaccggagtctggactggcaccag
ctggagggctgggaaggcgaactgcattccggcatctcggctctcgtcaccgacctgaac
cggatctaccgctcgcgacccgcgctgtacacccaggacatcgacccgctcggatacgag
tggatcgacgccaacgacaccgccaacaacgtgatcagcttcctgcggtacggcaccgac
ggctcggtcgtcgcatgcctgttcaacctcagcggctccgatcgcgccgattatcagatc
gggctcccgtcagcgggcgtctgggacgagatcctcaacaccgacgcggccgcctacagc
ggcgccggacggggcaacatggggtcggtgtccgcggacgggccgtcgtatcacggccgt
cccgtctccgcgcgggtcatgctccccgccaattcggcgatctggctcgtgccgcgggac
tag

DBGET integrated database retrieval system