KEGG   Gordonia sp. KTR9: KTR9_1892Help
Entry
KTR9_1892         CDS       T02216                                 

Definition
nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
gor  Gordonia sp. KTR9
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gor00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    KTR9_1892
Enzymes [BR:gor01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     KTR9_1892
    3.5.1.-  
     KTR9_1892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2148660..2149271)
Genome map
AA seq 203 aa AA seqDB search
MSAERSDGTRPADALIVVDVQNDFCEGGALGVNGGAAVARAVTSILDEYRTVVATRDYHI
DPGDHFSDDPDYVDTWPPHCRVGTDGVAFHREFDAGAAHEIFSKGEYSAAYSGFEGAADD
GSTLAVWLRERKVKTVDIVGIATDHCVRATALDAVAAGFTTRVLLNFTAGVAPETTSKAL
SALREAGVELVGDLLYDGSSHTG
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgaacgcagcgacggcacccggcccgccgacgcgctgatcgtcgtcgacgtg
cagaacgacttctgcgagggcggcgccctcggggtgaacggcggcgccgcggtcgcgcgg
gcggtcacgtcgatcctcgacgagtaccggaccgtcgtcgcgacccgcgactaccacatc
gaccccggtgaccacttctccgacgaccccgactacgtcgacacctggccgccccattgc
cgcgtcggcaccgacggtgtggcgttccatcgcgagttcgacgccggcgcggcgcacgag
atcttctccaagggcgaatacagcgccgcgtactccggtttcgagggagcggccgacgac
gggtcgaccctcgccgtctggctacgcgagcggaaggtcaagacggtcgacatcgtcggc
atcgccaccgaccactgcgtgcgggcgaccgcgctcgacgcggtggcagccggattcacc
acgcgggtccttctcaacttcacggccggcgtcgcgccggagaccacctcgaaggcgctg
tcggcgctgcgggaggcaggtgtcgaactcgtgggcgacctgctctacgacgggtcgagc
cacaccgggtag

DBGET integrated database retrieval system