KEGG   Gordonia sp. KTR9: KTR9_1892Help
Entry
KTR9_1892         CDS       T02216                                 

Definition
nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
gor  Gordonia sp. KTR9
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:gor00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2148660..2149271)
Genome map
AA seq 203 aa AA seqDB search
MSAERSDGTRPADALIVVDVQNDFCEGGALGVNGGAAVARAVTSILDEYRTVVATRDYHI
DPGDHFSDDPDYVDTWPPHCRVGTDGVAFHREFDAGAAHEIFSKGEYSAAYSGFEGAADD
GSTLAVWLRERKVKTVDIVGIATDHCVRATALDAVAAGFTTRVLLNFTAGVAPETTSKAL
SALREAGVELVGDLLYDGSSHTG
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgaacgcagcgacggcacccggcccgccgacgcgctgatcgtcgtcgacgtg
cagaacgacttctgcgagggcggcgccctcggggtgaacggcggcgccgcggtcgcgcgg
gcggtcacgtcgatcctcgacgagtaccggaccgtcgtcgcgacccgcgactaccacatc
gaccccggtgaccacttctccgacgaccccgactacgtcgacacctggccgccccattgc
cgcgtcggcaccgacggtgtggcgttccatcgcgagttcgacgccggcgcggcgcacgag
atcttctccaagggcgaatacagcgccgcgtactccggtttcgagggagcggccgacgac
gggtcgaccctcgccgtctggctacgcgagcggaaggtcaagacggtcgacatcgtcggc
atcgccaccgaccactgcgtgcgggcgaccgcgctcgacgcggtggcagccggattcacc
acgcgggtccttctcaacttcacggccggcgtcgcgccggagaccacctcgaaggcgctg
tcggcgctgcgggaggcaggtgtcgaactcgtgggcgacctgctctacgacgggtcgagc
cacaccgggtag

DBGET integrated database retrieval system