KEGG   Gordonia sp. KTR9: KTR9_2045Help
Entry
KTR9_2045         CDS       T02216                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
gor  Gordonia sp. KTR9
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:gor00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KTR9_2045
Enzymes [BR:gor01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     KTR9_2045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2326024..2327199
Genome map
AA seq 391 aa AA seqDB search
MPTRVLILGSTGSIGVQALEVVTEHPDLFEVVGLGAGGSHPGLLAEQAAAFGVPAARIAV
ADAARAPELSERLGGRVLGGPDAMCDLIDAVVADTGVDVILNAVVGSIGLAPSLTALRSG
ARLALANKESLVAGGALVLDAAAPGQIVPVDSEHSAIAQCLRAGTAAEVDRLVLTASGGP
FRGWTRAQLEDVTPEQAGHHPTWSMGPMITLNSATLVNKALEVIEAHLLFGVDYDHIDVT
VHPQSIVHSMVTFVDGATVAKASPPSMKLPIALALGWPDRVPGSSAACDFSTASSWTFEP
VDDTVFPAIELARRAGSAGGSLTAVYNAANEAAAAGFFAGAIRFPRIVEVIEEVLGEADQ
WARTPGTVEEVFAADRWARDSAAQLVAAASF
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
gtgcccacacgtgtgctgatcctcggttccaccggttccatcggcgtccaggcgctcgag
gtggtcaccgagcaccccgacctcttcgaggtggtcggcctcggtgccggcggatcgcac
cccggcctcctcgccgaacaggccgccgcgttcggcgtcccggccgcgcggatcgccgtc
gcggacgccgcgcgggcaccggaactctccgaacggctcggcggccgggtgctcggcggg
cccgacgccatgtgcgacctgatcgacgcggtcgtcgcggacaccggggtggatgtgatc
ctcaacgcggtcgtcgggtcgatcggactcgcgcccagtctcaccgcactccgatcgggt
gcccggctcgcgctggccaacaaggagtcgctcgtcgccggaggcgcactcgtcctcgac
gcggccgcgcccgggcagatcgtgccggtcgactccgagcactccgccatcgcgcagtgc
ctgcgcgccgggacggcagccgaggtcgaccggctggtcctcaccgcctcgggtggcccg
ttccgggggtggacccgcgcgcagctcgaggacgtcacccccgagcaggccggccaccat
cccacgtggtcgatgggtccgatgatcacgctcaactcggcgaccctggtcaacaaggcg
ctcgaggtcatcgaggcgcatctgctgttcggcgtcgactacgaccacatcgacgtcacc
gtccacccgcagtcgatcgtgcactcgatggtgaccttcgtcgacggcgcgaccgtggcc
aaggcctcaccgccgtcgatgaaactgcccatcgcgctggccctgggatggccggaccgg
gtgcccggttcgtcggccgcgtgcgacttctcgaccgcgtcgtcgtggacgttcgagccc
gtcgacgacacggtgttcccggcgatcgagctggcgcggcgcgcgggaagcgcggggggc
agcctgacggccgtctacaacgcggccaacgaggccgccgcggccgggttcttcgcgggc
gcgatcaggttcccgcgcatcgtcgaggtcatcgaggaggtgctcggcgaggccgatcag
tgggcccggacgccaggtactgtggaagaggtcttcgccgccgatcggtgggcccgggat
agcgctgcgcagctggtcgcggccgcatccttctga

  All links  
No link information was found.   
DBGET integrated database retrieval system