KEGG   Gordonia sp. KTR9: KTR9_2061Help
Entry
KTR9_2061         CDS       T02216                                 

Definition
Mg-chelatase subunit ChlI
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
gor  Gordonia sp. KTR9
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gor00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    KTR9_2061
Enzymes [BR:gor01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     KTR9_2061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2345962..2347980
Genome map
AA seq 672 aa AA seqDB search
MTTLGELPAPADLAADVRYPFSAVVGQEQLKLALILSAISPGIGGVLIRGEKGTAKSTIV
RGLGPLLGVPGSVADTAGRVVELPIGATEDRVIGSLDLTSVLRDGRAEFTPGLLARAHRG
VLYIDEVNLLADHLVDVLLDAAASGRVTVERDGVSHTQAADFVLVGTMNPEEGELRPQLL
DRFGLAVDVAAGREVDERVEVVRRRMAYDADPESFVAAHAAAEHELTQRIATARAAVGIV
ELPDRELRRIAGICAHLDVDGLRGDIVVARTALAHAAWRGAVVVEDVDVRAAVELALPHR
RRRNPFDESGLSSDQLDEAMSAGEDAAGPDSPDDDPGPPETPPPGGGGEPPASEPNETAT
APGAAHDTDTAEDPGTAPETGDGEVPQTAPGPAFGSAPVPTGRRMPTLRVDGLGDGDPGR
RSKARSRRGHTTHAVDFDAERPVHLFGTVLAAAGRATRGDDGFRPGGLRIAAPDLRSAQR
IGQESNLVVFVVDLSGSMTARRRLAAVSELCVEMLRDSYTRRDRVAVVVARGSAATLAVP
PTKSVEIAVRRLEEIRTGGRTPLGEGLQLAADVVERCRRAEPDRRPLLVVLTDGRATSGR
DASGRSAMARARQAADGIRRRGIGSVVVDCEQGMVRLGLAGDLAAHLGADLIPMDELSAT
ALTGPAPARGAA
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccctcggcgaactcccggcccccgccgatctggctgccgacgtgcgctacccg
ttcagtgcggtcgtcggccaggagcagctcaaactcgcgctcatcctctcggccatctcg
ccgggtatcggcggagtcctgatccgcggggagaagggcaccgcgaagtcgacgatcgtg
cgcggactgggtccgttgctcggcgtgcccgggtcggtggccgacaccgccggccgcgtc
gtggaactgccgatcggggcgaccgaggaccgcgtgatcggctcgctggacctcacctcg
gtccttcgggacggccgcgcggagttcacccccggcctgctcgcccgggcgcaccgcggg
gtcctctacatcgacgaggtcaacctgctcgccgaccacctcgtggacgtcctgctggat
gccgcggcgagcgggcgggtcaccgtcgaacgcgacggtgtgtcgcacacccaggcggcc
gatttcgtgctcgtcgggaccatgaacccggaagagggcgagctccgcccgcagctgctc
gaccggttcgggctcgccgtcgacgtggcagcgggtcgcgaggtcgacgaacgcgtggag
gtggtgcgccggcggatggcctacgacgccgatccggagtcgttcgtcgccgcccacgcc
gccgccgaacacgaactgacgcaacgcatcgcgacggcgcgggccgccgtgggcatcgtc
gagctcccggaccgggaactgcgccggatcgccgggatctgcgcccacctcgacgtcgac
ggactccgcggcgacatcgtcgtggcgcggaccgcgctcgcccacgccgcctggcgcgga
gccgttgtcgtcgaagacgtcgacgtccgggcggcggtggagctggcactgccacaccgg
cgccgccgcaacccgttcgacgagtcgggactcagctccgaccagctcgacgaggcgatg
tcggcgggtgaggacgcggccgggcccgactcacccgacgacgacccgggaccgccggag
acgccaccgcccggtggcggcggcgagccgccggcgtccgagccgaacgagaccgccacg
gctcccggcgcagcccacgacaccgacaccgccgaggatcccggcaccgcgcccgagacc
ggcgacggcgaggtcccgcagaccgcccccggccccgcgttcggctccgcgcctgttccg
accggtcgtcggatgccgaccctgcgggtcgacggactcggcgacggggatccgggccgt
cgctcgaaggcgcgcagccgtcgcgggcacaccacccatgccgtcgacttcgacgccgaa
cgaccggtccatctgttcggcaccgtgctcgccgctgccggccgggcgacacggggcgac
gacgggttccggccgggcggcctgcgtatcgcggcgccggatctgcggtcggcgcaacgg
atcggccaggagtcgaacctggtcgtcttcgtcgtcgacctcagcggttcgatgaccgcg
cggcgtcgtctggccgcggtgtccgagctgtgcgtggagatgctgcgtgactcctacacc
cgccgcgaccgcgtcgccgtggtcgtcgcgcggggttccgccgcgacactggcggtgccg
cccaccaaatccgtcgagatcgcggtgcgtcgcctcgaagagatccgtaccggtggccgc
acgccgctcggcgagggcctgcaactggccgccgacgtggtggagcggtgtcgacgggcg
gagcccgaccgccggccgttgctggtggtcctcaccgacggacgggccacctccgggcgc
gacgcgtcaggacgaagcgcgatggcacgcgcccggcaggccgcggacggcatccgccgc
cgcgggatcgggtccgtggtcgtcgactgcgagcagggcatggtccggctcggactcgcc
ggcgatctcgcggcccacctcggtgccgacctgatccccatggacgagctgtcggccacc
gccctcaccggaccggcacccgcacgcggggcggcctga

DBGET integrated database retrieval system