KEGG   Gordonia sp. KTR9: KTR9_2102Help
Entry
KTR9_2102         CDS       T02216                                 

Definition
Dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
gor  Gordonia sp. KTR9
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:gor00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    KTR9_2102
   00670 One carbon pool by folate
    KTR9_2102
Enzymes [BR:gor01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     KTR9_2102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2388387..2388878
Genome map
AA seq 163 aa AA seqDB search
MRLVWAQGRGGAIGRDNTIPWRVPEDMARFKELTVGHPVVMGRRTWDSLPPRFRPLPGRT
NVVVTRNAGWSADGAAVAGSVAEALDLAGDDRIGVIGGGEIYRLAMEFATELCVTEIDVE
VDGADAFAPPITDDWAVAEHGEWQTSTSGIDYRFVDYRRARQA
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
gtgcgactggtctgggcgcagggacgaggcggggcgatcggccgggacaacacgatccca
tggcgtgtccccgaggacatggcgcggttcaaggaactgacggtcggacatcccgtcgtc
atgggccgccggacatgggattcgctgccgccgcgctttcggccgctgcccggccgaacc
aatgtcgtcgtgacccgcaatgcgggatggtccgccgacggagcggccgtcgcgggatcg
gtcgccgaggcgctcgacctggccggcgatgaccggatcggagtcatcggcggcggcgag
atctaccggttggcaatggagttcgccaccgagctctgcgtcacggagatcgacgtcgag
gtcgacggcgccgacgcgttcgcgccgccgatcaccgacgactgggcggtggccgaacac
ggcgagtggcagacctcgacgagcgggatcgactaccggttcgtcgactaccggcgtgcc
cggcaggcctga

DBGET integrated database retrieval system