KEGG   Gordonia sp. KTR9: KTR9_2161Help
Entry
KTR9_2161         CDS       T02216                                 

Definition
(GenBank) Transcriptional regulator/sugar kinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
gor  Gordonia sp. KTR9
Pathway
gor00010  Glycolysis / Gluconeogenesis
gor00520  Amino sugar and nucleotide sugar metabolism
gor01100  Metabolic pathways
gor01110  Biosynthesis of secondary metabolites
gor01120  Microbial metabolism in diverse environments
gor01130  Biosynthesis of antibiotics
gor01200  Carbon metabolism
Module
gor_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gor00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KTR9_2161
   00520 Amino sugar and nucleotide sugar metabolism
    KTR9_2161
Enzymes [BR:gor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     KTR9_2161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AFR48798
UniProt: J9SI18
Position
complement(2454395..2455198)
Genome map
AA seq 267 aa AA seqDB search
MTDTSVPGSSDPDDPTPPTNLGFGVDVGGSGIKGGIVDLDSGELVGERFKVLTPQPATPD
AVADKVAEVVAHFDWTGPVGITLPGVVTDGIMRTAANIDKAWIGTDVYDLFSKHLDGRQV
SVLNDADAAGMAEDAYGAGKDVAGVVMLLTFGTGIGSAILIDGTLVPNTELGHLQVGKKE
AEHQASSRVRDEKGWSYEKWTEKVSEVLKTYEALFWPKLFIAGGGISRKSDKWIPLLTND
TPVVPAVLLNTAGIVGAAMAVSRGLKT
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatacgtccgtccctggatcgtccgaccccgacgatccgacacctccgaccaac
ctcggtttcggggtcgacgtcggcggttccgggatcaagggcgggatcgtcgatctcgat
tccggtgaactcgtcggcgagcggttcaaggtgctgaccccgcagccggcgacccccgac
gccgtcgccgacaaggtggccgaggtcgtggcacatttcgactggaccggaccggtgggc
atcaccctgcccggcgtcgtcaccgacgggatcatgcgcacggccgccaacatcgacaag
gcctggatcggtacggacgtctacgacctcttcagcaagcacctcgacggcaggcaggtg
tcggtgctcaacgacgccgacgccgcggggatggccgaggacgcgtacggcgcgggcaag
gacgtcgccggggtcgtgatgctgctgacgttcggaaccggcatcgggtcggcgatcctg
atcgacggaaccctcgtgccgaacaccgagctcggtcatctccaggtcggcaagaaggaa
gccgagcaccaggcgtcctctcgcgtccgggacgagaagggttggtcatacgagaagtgg
accgagaaggtctccgaggtcctgaagacctacgaggccctcttctggccgaagctgttc
atcgcgggcggcggcatcagccgcaagtccgacaagtggattccgctgttgaccaatgac
acgcccgtggtccccgcggtgctgctgaacaccgccggcatcgtgggtgccgccatggcg
gtctcgcgggggctcaaaacctag

DBGET integrated database retrieval system