KEGG   Gordonia sp. KTR9: KTR9_2181Help
Entry
KTR9_2181         CDS       T02216                                 

Definition
Protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
gor  Gordonia sp. KTR9
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:gor00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    KTR9_2181
Enzymes [BR:gor01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     KTR9_2181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2473593..2475014
Genome map
AA seq 473 aa AA seqDB search
MSPRVRIAIVGGGISGLTAAYRLRRALGSDAHIDLFEATARLGGVLHTATVGDRPVDVGA
EAFIVRRPEALELVTELGLADRVVSPTPRRPAVWSGERLHPLPSPALMGIPAGPAVVDGL
ADPADIERMTGEPERPMSWGTGADASVGQLVAERFGPSVVARSVDPMLGGVYSSLAGDIG
VREALPALAARLDAGAPSLTAAVGALIAAGAGASGPVFGALVGGYAILLDALRTAAGVDP
DTSSPVTELVPSGDGWELDVDGAADRRPYDGVILAVPAWRAGDLLHRSVPDLSVPLRTVR
RASSVVVSIAFAPGTALPEHSGVLVGTGEGLRAKAFTFSSQKWAHLSGPDTSGADRPVSV
RASFGRFGAPVPDEATEPGVDDRLRRAALEDLDEVCRAAGVAPVSSRVVDVYVQRWDDGL
PVYAPGHLAAMARVLAARPPRLALAGSSYAGVGVPACIGRAGRAAAELLDDLT
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgtccccgcgggtccggatcgcgatcgtcggcggcgggatctccggcctgaccgccgcc
taccgcctccgtcgtgccctcgggtcggacgcgcacatcgacctcttcgaggccaccgca
cggctgggtggtgtgctgcacacggcgaccgtcggcgaccggcccgtcgacgtcggcgcc
gaggcgttcatcgtccggcgccccgaggcgctcgaactcgtcaccgaactcggcctggcc
gaccgggtcgtctcaccgactccgcgacgtcccgcggtgtggtcgggggagcggttgcac
ccgctgcccagtccggcgctgatgggcatcccggccgggccggcggtggtcgacggtctc
gccgaccccgccgacatcgagcgtatgaccggcgaacccgaacgcccgatgagctggggg
accggcgccgacgcgtccgtcgggcaactcgtcgccgaacggttcggaccctccgtggtc
gcccgcagcgtcgacccgatgctcggcggtgtgtactccagcctcgccggcgacatcggg
gtccgtgaggcgctcccggcactcgccgcgcgcctggacgcgggcgcgccgtcgctcacg
gcggccgtcggggccctcatcgccgccggtgcgggcgcgtcgggacccgtcttcggtgca
ctcgtgggcggctacgcgatcctcctcgacgccctgcggaccgcggccggggtcgacccc
gacaccagcagtccggtcaccgaactcgttccgtcgggggatggctgggagctcgacgtg
gacggggccgcagaccggcgaccgtacgacggcgtgatcctggcggtgccggcctggcgg
gccggcgacctcctgcaccgatccgtgccggacctgtccgttccgttgcggaccgtccgg
cgcgcctcgtcggtcgtggtgtcgatcgcgttcgcgccgggcacagcgctgcccgagcac
tcgggtgtgctggtgggcaccggagaagggttgcgcgccaaggcgttcacgttcagctca
cagaagtgggcccatctgtcggggccggacacctctggcgcggaccggccggtgtcggtc
cgggcgtcgttcgggcggttcggtgcgccggtaccggatgaggccaccgaacccggggtc
gacgaccggttgcggcgtgcggcgctggaggatctcgacgaggtgtgccgtgccgccggc
gtcgcaccggtgtcgtcgcgggtcgtcgacgtgtacgtgcagcgctgggacgacgggctg
ccggtctatgcgccgggccacctcgcggcgatggcgcgggtgctggccgcgcgcccaccg
cgcctcgcactggccgggtcgtcgtacgcaggggtcggggtaccggcgtgtatcggccgg
gccggccgcgcggcggccgagctgctcgacgatctgacgtga

DBGET integrated database retrieval system