KEGG   Gordonia sp. KTR9: KTR9_2218Help
Entry
KTR9_2218         CDS       T02216                                 

Definition
Holliday junction resolvasome, DNA-binding subunit
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
gor  Gordonia sp. KTR9
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gor00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    KTR9_2218
Enzymes [BR:gor01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     KTR9_2218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2518113..2518706
Genome map
AA seq 197 aa AA seqDB search
MIASVRGPVLEIALDHAVIDCGGVGYRVLATPATLSRLHRGDEATLLTSMIVREDSMTLY
GFTEPDARSLFALLQTVTGVGPRLAMATLAVLEPDALRRALAESDTKALTSVPGIGKRVA
ERLCVELRDKVDRPTGEPSGGVTVVGGIRDQVAEALVGLGFTPGPAEKAVTAVLAEHPDA
DASTALRHSLSLLGKAS
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcgtcagtccgcggaccggtgctcgagatcgccctcgaccacgccgtgatcgac
tgcggaggagtgggttatcgcgtgctcgccacccccgcgacactgtcccggctccaccgg
ggcgacgaggcgacgctgctgacctcgatgatcgtccgcgaggactcgatgacgctctac
ggcttcaccgaacccgacgcccgttccctcttcgcgctcctgcagacggtgaccggcgtc
ggtccgcgactggcgatggccaccctcgcggtcctcgagcccgatgcgctgcgccgcgcg
ctcgccgagtccgacaccaaggccctcacctcggttccgggtatcggcaagcgggtggcc
gaacggctctgcgtcgaactgcgggacaaggtcgaccggcccaccggcgagccgtcgggc
ggtgtcacggtcgtcggcggcatccgcgatcaggtggccgaggccctcgtcggcctcggg
ttcacgcccggccccgccgagaaggcggtcaccgcggtactcgccgaacatcccgatgcc
gacgcgtcgacggcgctccggcactcgttgtcgctgctgggaaaggcgtcctag

DBGET integrated database retrieval system