KEGG   Gordonia sp. KTR9: KTR9_2253Help
Entry
KTR9_2253         CDS       T02216                                 

Definition
Aspartate carbamoyltransferase, catalytic chain
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
gor  Gordonia sp. KTR9
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:gor00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:gor00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2561627..2562580
Genome map
AA seq 317 aa AA seqDB search
MMRHLLSAQDLSRDDATALLDDAERFEQALTGREVRKLPTLRGRTVMTVFYENSTRTRVS
FEVAGKWMSADVINVSASSSSAGKGESLRDTAKTLHAAGADALIVRHPASGAPAQIADWT
TTPDGDGPAVINAGDGTHEHPTQALLDALTLRQRLGSLEGRRIAIVGDIIHSRVARSNAH
LLSTLGAEVVLVAPPTLLPVGVDEWPVSVSGSLDAELPAVDAVMMLRVQAERMNGGFFPS
AREYSVRFGLNDRRLGLLHDDAVVLHPGPMLRGMEIGYSVADSPKATVLEQVRNGVHVRM
AVLFRLLVGSDSAGAHL
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
gtgatgcggcacctgctgtcggcccaagacctcagccgcgacgacgccaccgccctcctc
gacgacgccgaacgtttcgaacaggccctcaccgggcgcgaggttcgtaagctgccgacg
ctgcgcgggcgcacggtgatgaccgtgttctacgagaactccacccgcaccagggtctcc
ttcgaggtcgcgggcaagtggatgagcgccgacgtcatcaacgtcagtgcctcgagttcc
tctgcgggcaaaggggaatcgctgcgcgacacggccaagaccctgcacgcggccggcgcc
gacgcgctgatcgtccggcacccggcctcgggtgcgccggcccagatcgccgactggacg
acgacgccggacggcgacggccccgcggtgatcaacgccggtgacgggacacacgagcat
cccacccaggcgctgctcgacgcgctgacgctccgccagcgcctcgggtcgctcgagggc
aggcgcatcgcgatcgtgggcgacatcatccattcccgtgtcgcgcggtcgaacgcccat
ctgctgtcgacgctcggcgccgaggtcgtcctggtggcgcccccgacgctgttgccggtc
ggcgtcgacgagtggccggtgagcgtctcgggaagcctcgacgccgaactccccgccgtc
gacgcggtgatgatgctccgggtccaggccgaacgcatgaacggcgggttcttcccgagt
gcccgcgagtactcggtccgattcgggctgaacgaccgccgcctgggactgctgcacgac
gacgcggtggtcctgcatcccgggccgatgctgcgcggcatggagatcggctactcggtg
gccgattcgcccaaggccaccgttctcgaacaggtccgcaacggtgtgcacgtccggatg
gcggttctcttccgcctgctcgtcggttcggattccgcaggagcccacctatga

DBGET integrated database retrieval system