KEGG   Gordonia sp. KTR9: KTR9_2260Help
Entry
KTR9_2260         CDS       T02216                                 

Definition
Guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
gor  Gordonia sp. KTR9
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:gor00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2570743..2571372
Genome map
AA seq 209 aa AA seqDB search
MDRTVNNRPNHEGTGRTRGRLIVLVGPSAVGKSTVVAKVCAAVPDVYFSVSATTRDPRPG
EVDGRDYHFVSAGEFDRMIAADELLEWAEIHGGLQRSGTPIAPVLAALEAGKPVLVEVDL
VGARNVVARLPEAVTVFLAPPSWDELVSRLTGRATETPEAIERRLATARTEMAAQDEFDH
VIVNSEVDRAADQLVSLLVGPEQPAASAT
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
gtggaccggacggtgaacaaccgcccgaaccacgagggaaccggacgcacgaggggtcga
ctgatcgttttggtcggcccctcggccgtcggcaagtccaccgtggtcgcaaaggtctgc
gccgcggtgcccgacgtctacttcagcgtgtcggcgacgacgcgcgacccgcggcccggc
gaagtcgacggccgcgactaccacttcgtctcggccggcgagttcgaccggatgatcgcc
gccgacgagctcctggagtgggccgagatccacggcgggctgcagcgctcgggcaccccg
atcgccccggtcctggccgcactggaagccggtaagccggttctggtcgaggtcgacctg
gtcggcgcgcgcaatgtggtggcccgactccccgaggcggtcaccgtcttcctcgcacca
cccagctgggacgaactcgtgtcccgcctgaccggccgggccaccgagacgcccgaggcg
atcgagcgccgactcgccaccgctcggaccgaaatggccgcccaggacgagttcgatcac
gtcatcgtgaacagcgaagtcgaccgggccgccgatcagttggtatccttgctggtcgga
cccgaacagccggccgcatccgcgacctga

DBGET integrated database retrieval system