KEGG   Gordonia sp. KTR9: KTR9_2284Help
Entry
KTR9_2284         CDS       T02216                                 

Definition
Triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gor  Gordonia sp. KTR9
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:gor00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KTR9_2284
   01230 Biosynthesis of amino acids
    KTR9_2284
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KTR9_2284
   00051 Fructose and mannose metabolism
    KTR9_2284
   00562 Inositol phosphate metabolism
    KTR9_2284
Enzymes [BR:gor01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     KTR9_2284
Exosome [BR:gor04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   KTR9_2284
  Exosomal proteins of bladder cancer cells
   KTR9_2284
  Exosomal proteins of melanoma cells
   KTR9_2284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2597869..2598657
Genome map
AA seq 262 aa AA seqDB search
MAQRKPLIAGNWKMNLNHLEAIALVQKIAFALPAKYFDKVDVTVIPPFTDIRSVQTVVDG
DKLLLTYGAQDLSAHDSGAYTGEISGAFLAKLGCTFVVVGHSERRTLHGETDEVVLAKTK
AALKHELTPIVCIGEGLDVREAGEHVAYNVAQLKGSLAGLSAAEIAKTVIAYEPVWAIGT
GRVAGADDAQEVCKAIREALVDIADADTAASVRILYGGSVNAKNVGDLVGRPDVDGALVG
GASLKSDEFATLSAIAAGGPLP
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggcacagcgtaagccgctcatcgcgggcaactggaagatgaacctgaaccatctcgag
gcgatcgcgctggtgcagaagatcgcgttcgcgctgccggcgaagtacttcgacaaggtc
gacgtgacggtgatcccgccgttcaccgacatccgcagcgtgcagaccgtcgtcgacggg
gacaagctgctgctcacctacggtgcgcaggatctgtccgcacacgactcgggtgcctat
acgggcgagatcagcggcgcgttcctcgcgaagctcggctgcacgttcgtggtcgtcggg
cactccgagcggcgcacgctgcacggtgagaccgacgaggtcgtgctcgccaagaccaag
gccgcgctcaagcacgagctcacgccgatcgtgtgcatcggcgaggggctcgacgtccgc
gaggccggcgagcacgtggcgtacaacgtcgcgcagctcaagggctcgctcgccggtctg
tccgccgccgagatcgccaagaccgtcatcgcctacgagccggtctgggcgatcggcacc
ggtcgggtggccggcgcggacgacgcgcaagaggtctgcaaggccatccgtgaggccctg
gtggacatcgccgacgccgacaccgcggcatcggtgcgcatcctctacggcggatcggtc
aacgccaagaatgtcggcgacctggtcggacgaccggacgtcgacggcgcgctggtgggc
ggggcctcgctgaagtccgacgagttcgcgacgctgtcggcgatcgccgcgggtggcccc
ttgccctga

DBGET integrated database retrieval system