KEGG   Gordonia sp. KTR9: KTR9_2284Help
Entry
KTR9_2284         CDS       T02216                                 

Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gor  Gordonia sp. KTR9
Pathway
gor00010  Glycolysis / Gluconeogenesis
gor00051  Fructose and mannose metabolism
gor00562  Inositol phosphate metabolism
gor01100  Metabolic pathways
gor01110  Biosynthesis of secondary metabolites
gor01120  Microbial metabolism in diverse environments
gor01130  Biosynthesis of antibiotics
gor01200  Carbon metabolism
gor01230  Biosynthesis of amino acids
Module
gor_M00002  Glycolysis, core module involving three-carbon compounds
gor_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:gor00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KTR9_2284
   00051 Fructose and mannose metabolism
    KTR9_2284
   00562 Inositol phosphate metabolism
    KTR9_2284
Enzymes [BR:gor01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     KTR9_2284
Exosome [BR:gor04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   KTR9_2284
  Exosomal proteins of bladder cancer cells
   KTR9_2284
  Exosomal proteins of melanoma cells
   KTR9_2284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFR48921
UniProt: J9S2Y8
Position
2597869..2598657
Genome map
AA seq 262 aa AA seqDB search
MAQRKPLIAGNWKMNLNHLEAIALVQKIAFALPAKYFDKVDVTVIPPFTDIRSVQTVVDG
DKLLLTYGAQDLSAHDSGAYTGEISGAFLAKLGCTFVVVGHSERRTLHGETDEVVLAKTK
AALKHELTPIVCIGEGLDVREAGEHVAYNVAQLKGSLAGLSAAEIAKTVIAYEPVWAIGT
GRVAGADDAQEVCKAIREALVDIADADTAASVRILYGGSVNAKNVGDLVGRPDVDGALVG
GASLKSDEFATLSAIAAGGPLP
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggcacagcgtaagccgctcatcgcgggcaactggaagatgaacctgaaccatctcgag
gcgatcgcgctggtgcagaagatcgcgttcgcgctgccggcgaagtacttcgacaaggtc
gacgtgacggtgatcccgccgttcaccgacatccgcagcgtgcagaccgtcgtcgacggg
gacaagctgctgctcacctacggtgcgcaggatctgtccgcacacgactcgggtgcctat
acgggcgagatcagcggcgcgttcctcgcgaagctcggctgcacgttcgtggtcgtcggg
cactccgagcggcgcacgctgcacggtgagaccgacgaggtcgtgctcgccaagaccaag
gccgcgctcaagcacgagctcacgccgatcgtgtgcatcggcgaggggctcgacgtccgc
gaggccggcgagcacgtggcgtacaacgtcgcgcagctcaagggctcgctcgccggtctg
tccgccgccgagatcgccaagaccgtcatcgcctacgagccggtctgggcgatcggcacc
ggtcgggtggccggcgcggacgacgcgcaagaggtctgcaaggccatccgtgaggccctg
gtggacatcgccgacgccgacaccgcggcatcggtgcgcatcctctacggcggatcggtc
aacgccaagaatgtcggcgacctggtcggacgaccggacgtcgacggcgcgctggtgggc
ggggcctcgctgaagtccgacgagttcgcgacgctgtcggcgatcgccgcgggtggcccc
ttgccctga

DBGET integrated database retrieval system