KEGG   Gordonia sp. KTR9: KTR9_2284Help
Entry
KTR9_2284         CDS       T02216                                 

Definition
Triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gor  Gordonia sp. KTR9
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:gor00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KTR9_2284
   01230 Biosynthesis of amino acids
    KTR9_2284
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KTR9_2284
   00051 Fructose and mannose metabolism
    KTR9_2284
   00562 Inositol phosphate metabolism
    KTR9_2284
Enzymes [BR:gor01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     KTR9_2284
Exosome [BR:gor04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   KTR9_2284
  Exosomal proteins of bladder cancer cells
   KTR9_2284
  Exosomal proteins of melanoma cells
   KTR9_2284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2597869..2598657
Genome map
AA seq 262 aa AA seqDB search
MAQRKPLIAGNWKMNLNHLEAIALVQKIAFALPAKYFDKVDVTVIPPFTDIRSVQTVVDG
DKLLLTYGAQDLSAHDSGAYTGEISGAFLAKLGCTFVVVGHSERRTLHGETDEVVLAKTK
AALKHELTPIVCIGEGLDVREAGEHVAYNVAQLKGSLAGLSAAEIAKTVIAYEPVWAIGT
GRVAGADDAQEVCKAIREALVDIADADTAASVRILYGGSVNAKNVGDLVGRPDVDGALVG
GASLKSDEFATLSAIAAGGPLP
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggcacagcgtaagccgctcatcgcgggcaactggaagatgaacctgaaccatctcgag
gcgatcgcgctggtgcagaagatcgcgttcgcgctgccggcgaagtacttcgacaaggtc
gacgtgacggtgatcccgccgttcaccgacatccgcagcgtgcagaccgtcgtcgacggg
gacaagctgctgctcacctacggtgcgcaggatctgtccgcacacgactcgggtgcctat
acgggcgagatcagcggcgcgttcctcgcgaagctcggctgcacgttcgtggtcgtcggg
cactccgagcggcgcacgctgcacggtgagaccgacgaggtcgtgctcgccaagaccaag
gccgcgctcaagcacgagctcacgccgatcgtgtgcatcggcgaggggctcgacgtccgc
gaggccggcgagcacgtggcgtacaacgtcgcgcagctcaagggctcgctcgccggtctg
tccgccgccgagatcgccaagaccgtcatcgcctacgagccggtctgggcgatcggcacc
ggtcgggtggccggcgcggacgacgcgcaagaggtctgcaaggccatccgtgaggccctg
gtggacatcgccgacgccgacaccgcggcatcggtgcgcatcctctacggcggatcggtc
aacgccaagaatgtcggcgacctggtcggacgaccggacgtcgacggcgcgctggtgggc
ggggcctcgctgaagtccgacgagttcgcgacgctgtcggcgatcgccgcgggtggcccc
ttgccctga

DBGET integrated database retrieval system