KEGG   Gordonia sp. KTR9: KTR9_2317Help
Entry
KTR9_2317         CDS       T02216                                 

Definition
(GenBank) Choline dehydrogenase-like flavoprotein
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
gor  Gordonia sp. KTR9
Pathway
gor00984  Steroid degradation
gor01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gor00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    KTR9_2317
Enzymes [BR:gor01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     KTR9_2317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C Pyr_redox_2 NAD_binding_8 TAT_signal FAD_binding_2 GMC_oxred_N DUF761 FAD_binding_3 GIDA
Motif
Other DBs
NCBI-ProteinID: AFR48954
UniProt: J9SF89
Position
complement(2635435..2637048)
Genome map
AA seq 537 aa AA seqDB search
MVNYDNSGPAVSRRTLMRSAAGVGALAALGATTTPAQAAPGQTAIVIGTGFGGAVAARRL
GEAGYKTTVFERGRRWPIRPDGNTFATTTNPDKRAAWFGSPAGASAASGIPVEPYPGVLD
HVMGNGVEAVYGAGVGGGSLVFGSFTPVPRRQDFNHIFPAAADYAQLAQTYYPRAKAGLG
VSPLPADILAHPKYVGARSWLKVIERYGASPHFFDFAIDWDIVRDELAGRATPSVSAGEL
SYGVNSGAKKSLDRSYLLAAERTGNVSVKPMHEVFDIRPRSRRAGFVVTARVLDEQGRTV
RTVTSEADHLFMAAGSFHTTRLLVEARAQGRLPRLSSRIGDGFGVNGDFLTIRANPREDF
GAVQGGPGYARIYEDDLPGGPVSMVYQATPLPAPLGKAATTHLVQAHTDERGTIDYDHRT
RRAQLNYPHPADRNDLDRRSNAFIARFHERTEGRFGFRANGTHISSRALGFGSASTYHGL
GGVVMGAAADMDGGVRGYDNLWVVDGSFVPGAVGLVNPALTITALAERTMDRFLATH
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
gtggtgaactacgacaattccggtccggcagtctctcgccggaccctcatgcgctccgcg
gccggcgtcggggccctcgccgcgctcggcgcgaccacgactccggcgcaggcggcgccg
gggcagaccgcgattgtcatcggcaccggcttcggcggcgcggtggcggcccgacgcctc
ggcgaggccggatacaagacaacggttttcgagcgcggtcgccgctggccgatccgcccg
gacggcaacaccttcgccacgacgaccaatccggacaaacgcgcggcgtggttcggcagc
ccggccggcgcaagtgcggcgagcggcatcccggtcgagccgtaccccggtgttctcgac
cacgtgatgggcaacggcgtcgaggccgtgtacggcgcgggcgtgggtggcgggtcactc
gtcttcggctcgttcacgcccgtcccccgccgccaggacttcaaccacatcttcccggcg
gccgcggactacgcgcagctcgcccagacctattacccgcgcgccaaggcggggctcggc
gtctcgccgctgcccgcggacatcctcgcccatcccaagtacgtcggcgcccgctcgtgg
ctcaaggtcatcgagcgttacggggcgtcaccgcacttcttcgacttcgccatcgactgg
gacatcgtccgcgacgaactcgccggccgggccaccccgtcggtctccgccggcgaactc
agctacggagtcaacagcggcgccaagaagtcactcgaccgcagctacctcctcgccgcc
gaacggaccggcaacgtctccgtcaagccgatgcacgaggtcttcgacatccggccccgg
tcgcggcgcgccggattcgtcgtcaccgcaagggttctcgacgaacaggggcgcacggta
cgcaccgtgaccagcgaggccgatcatctcttcatggccgcgggctccttccacaccacc
cggctgctcgtcgaggcccgcgcccaggggcgcctgccacggctgtcgtcgcgcatcggt
gacggcttcggcgtgaacggcgacttcctcaccatccgggcgaacccgcgcgaggacttc
ggtgccgtccagggcggaccgggctacgcccggatctacgaggacgatctgcccggcggg
ccggtctcgatggtctatcaggccaccccgctgcccgccccgctcggcaaggccgcgacc
acccacctggtgcaggcacacaccgacgagcgcggcacgatcgactacgaccaccgcacg
cggcgcgcacagctgaactacccccacccggccgaccgcaatgatctcgaccgccgcagc
aatgcattcatcgcacggttccacgaacgcaccgagggccgcttcggcttccgcgcgaac
ggcactcacatatcatcgcgtgcgctcggattcggttccgcgagcacgtatcacggactc
ggcggcgtggtgatgggcgcagcggccgacatggacggcggcgtacgcgggtacgacaac
ctgtgggtcgtcgacggctcgttcgtgccgggcgccgtgggtctggtgaatcccgcgctg
acgatcaccgccctcgcggaacgcaccatggacaggtttctcgcgacgcactga

DBGET integrated database retrieval system