KEGG   Gordonia sp. KTR9: KTR9_2317Help
Entry
KTR9_2317         CDS       T02216                                 

Definition
Choline dehydrogenase-like flavoprotein
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
gor  Gordonia sp. KTR9
Pathway
Steroid degradation
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation [PATH:gor00984]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2635435..2637048)
Genome map
AA seq 537 aa AA seqDB search
MVNYDNSGPAVSRRTLMRSAAGVGALAALGATTTPAQAAPGQTAIVIGTGFGGAVAARRL
GEAGYKTTVFERGRRWPIRPDGNTFATTTNPDKRAAWFGSPAGASAASGIPVEPYPGVLD
HVMGNGVEAVYGAGVGGGSLVFGSFTPVPRRQDFNHIFPAAADYAQLAQTYYPRAKAGLG
VSPLPADILAHPKYVGARSWLKVIERYGASPHFFDFAIDWDIVRDELAGRATPSVSAGEL
SYGVNSGAKKSLDRSYLLAAERTGNVSVKPMHEVFDIRPRSRRAGFVVTARVLDEQGRTV
RTVTSEADHLFMAAGSFHTTRLLVEARAQGRLPRLSSRIGDGFGVNGDFLTIRANPREDF
GAVQGGPGYARIYEDDLPGGPVSMVYQATPLPAPLGKAATTHLVQAHTDERGTIDYDHRT
RRAQLNYPHPADRNDLDRRSNAFIARFHERTEGRFGFRANGTHISSRALGFGSASTYHGL
GGVVMGAAADMDGGVRGYDNLWVVDGSFVPGAVGLVNPALTITALAERTMDRFLATH
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
gtggtgaactacgacaattccggtccggcagtctctcgccggaccctcatgcgctccgcg
gccggcgtcggggccctcgccgcgctcggcgcgaccacgactccggcgcaggcggcgccg
gggcagaccgcgattgtcatcggcaccggcttcggcggcgcggtggcggcccgacgcctc
ggcgaggccggatacaagacaacggttttcgagcgcggtcgccgctggccgatccgcccg
gacggcaacaccttcgccacgacgaccaatccggacaaacgcgcggcgtggttcggcagc
ccggccggcgcaagtgcggcgagcggcatcccggtcgagccgtaccccggtgttctcgac
cacgtgatgggcaacggcgtcgaggccgtgtacggcgcgggcgtgggtggcgggtcactc
gtcttcggctcgttcacgcccgtcccccgccgccaggacttcaaccacatcttcccggcg
gccgcggactacgcgcagctcgcccagacctattacccgcgcgccaaggcggggctcggc
gtctcgccgctgcccgcggacatcctcgcccatcccaagtacgtcggcgcccgctcgtgg
ctcaaggtcatcgagcgttacggggcgtcaccgcacttcttcgacttcgccatcgactgg
gacatcgtccgcgacgaactcgccggccgggccaccccgtcggtctccgccggcgaactc
agctacggagtcaacagcggcgccaagaagtcactcgaccgcagctacctcctcgccgcc
gaacggaccggcaacgtctccgtcaagccgatgcacgaggtcttcgacatccggccccgg
tcgcggcgcgccggattcgtcgtcaccgcaagggttctcgacgaacaggggcgcacggta
cgcaccgtgaccagcgaggccgatcatctcttcatggccgcgggctccttccacaccacc
cggctgctcgtcgaggcccgcgcccaggggcgcctgccacggctgtcgtcgcgcatcggt
gacggcttcggcgtgaacggcgacttcctcaccatccgggcgaacccgcgcgaggacttc
ggtgccgtccagggcggaccgggctacgcccggatctacgaggacgatctgcccggcggg
ccggtctcgatggtctatcaggccaccccgctgcccgccccgctcggcaaggccgcgacc
acccacctggtgcaggcacacaccgacgagcgcggcacgatcgactacgaccaccgcacg
cggcgcgcacagctgaactacccccacccggccgaccgcaatgatctcgaccgccgcagc
aatgcattcatcgcacggttccacgaacgcaccgagggccgcttcggcttccgcgcgaac
ggcactcacatatcatcgcgtgcgctcggattcggttccgcgagcacgtatcacggactc
ggcggcgtggtgatgggcgcagcggccgacatggacggcggcgtacgcgggtacgacaac
ctgtgggtcgtcgacggctcgttcgtgccgggcgccgtgggtctggtgaatcccgcgctg
acgatcaccgccctcgcggaacgcaccatggacaggtttctcgcgacgcactga

DBGET integrated database retrieval system