KEGG   Gordonia sp. KTR9: KTR9_2488Help
Entry
KTR9_2488         CDS       T02216                                 

Definition
Glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
gor  Gordonia sp. KTR9
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:gor00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:gor00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2853607..2854083)
Genome map
AA seq 158 aa AA seqDB search
MTSAYDFTATGIDGNPVELSEFQGSPLLIVNTASQCGFTPQYRGLEALHRDYADKGLRVL
GFPCDQFGHQEPGDEDEIKNFCSLTYDVTFPMFAKVDVNGPDAHPLFAWLRDQKSGVLGG
RIKWNFTKFLIGRDGSVVARYAPTTKPEKLAGSIEEQL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgacctctgcgtacgacttcaccgccaccggtatcgacggcaaccccgtcgaactctcg
gaattccagggcagtcccctgctcatcgtgaacaccgcctcgcagtgcggattcaccccg
cagtaccgcggcctggaggccttgcaccgcgactacgccgacaaggggctgcgcgtcctc
ggctttccctgcgatcagttcgggcaccaggagcccggtgacgaggacgagatcaagaac
ttctgctcgctgacctacgacgtgactttcccgatgttcgcgaaggtcgacgtgaacggt
cccgacgcccacccgctgttcgcatggctgcgggaccagaagtccggcgtcctcggcggg
cgcatcaaatggaacttcaccaagttcctgatcggccgggacgggtcggtcgtcgcgcgg
tatgccccgaccaccaagccggagaaactcgccgggtccatcgaagaacagctgtga

DBGET integrated database retrieval system