KEGG   Gordonia sp. KTR9: KTR9_2623Help
Entry
KTR9_2623         CDS       T02216                                 

Definition
ATP-dependent exoDNAse (exonuclease V), alpha subunit - helicase superfamily I member
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
gor  Gordonia sp. KTR9
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gor00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    KTR9_2623
Enzymes [BR:gor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     KTR9_2623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2994926..2996788)
Genome map
AA seq 620 aa AA seqDB search
MSSSDVQVTEWATGVLAEWNEAGVLAAADVHITDRLVAMCAEPVSETARLGAALAVRAVR
LGSTCLALDRLGDLAGETSPALTVPSSDAMLHALLESPLVAGSEAGPLRPLVVRRSVDGP
LVYLQKYFRQEQTIRDTLARRAQTSPAVDADALRAAIAAVYTSPEDGRLQKLAAAVAATR
WTTVLAGGPGTGKTYTVARILAVLDALQGPGLRIGLCAPTGRAAAQLQASVEAESTVPVT
AHAITLHSLLGWRPGANPRYGRGRTLPHDVIVVDETSMLSMTAMSRLLDAVRPDARVIFV
GDPHQLASVEAGAVLADLVERTDVIGVQADSDAGVRASQAALEAVGPAGEDLDPADTDRL
ADGVITLRRQFRFGGGISRVAAAVNSGDADEVVRLVTADDVPNVELVSADDLDDVRADVV
EWGMALRTAARDADAEAALDALDTHRVLCAHREGSSGVRGWSARITEWLGTAGAEHTGWY
PGQPILVTANDRQTSTFNGDTGVVIADPDGRMQGADAVRVAFRRGGSVRLLHPTQLADVE
SVHAMTIHRSQGSQFRQVTVILPPPGSELLTRELLYTAITRARERVRIVGTPEVLAAAVD
RRVQRASGLRSAVTPFGDTE
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgtccagttccgatgtgcaggtgactgagtgggccaccggtgtgctcgccgagtggaac
gaggccggtgtgctggccgcggcagacgtgcacatcaccgatcggctcgtggcgatgtgc
gccgaaccggtctccgagaccgcgcgcctcggcgccgcgctcgccgtacgtgcggtgcgg
ctgggttcgacgtgcctggcgctggaccggttgggtgacctggccggcgagaccagcccg
gctctcacggttccgtcgtcggatgcgatgctccacgcgttgctggagagtccgctcgtg
gccggcagcgaggcgggtccgttgcgtccgttggtcgtacggcggtccgtcgacgggccg
ctggtctatctccagaagtacttccggcaggagcagacgatccgggacacgctggcccgc
cgcgcacagacgtcaccggccgtcgacgccgacgccctgcgcgccgcgatcgccgccgtg
tacacctcgccggaggacggccggctgcagaagctcgccgccgcggtcgccgcgacccga
tggacgaccgtcctggcgggcggtccgggcaccggcaagacctacaccgtcgcacgcatt
ctcgccgtactcgacgcgctgcagggccccggcctccggatcggactgtgtgcgcccacc
ggccgggcggccgcccagctgcaggcctcggtggaggcggagtcgacggtgccggtcacg
gcgcacgccatcaccctgcactcgctgctcggctggcgcccgggagccaacccgaggtat
ggccgcgggcgtacattgccgcacgatgtgatcgtcgtcgacgagacatccatgctgtcg
atgaccgcgatgagccggctgctcgacgcggtccggcccgacgcgcgcgtgatcttcgtc
ggtgacccgcatcagctcgcgtcggtcgaggcgggtgcggtgctggccgatctcgtcgaa
cggaccgatgtcatcggggtgcaggcggactcggacgctggggtgagggcgtcgcaggcc
gcgctggaagcggtgggtccggccggcgaagacctggacccggccgacacggatcgcctc
gccgacggcgtcatcaccctgcgtcggcagttccggttcggcggtggcatctcgcgggtg
gccgccgccgtgaattccggcgacgccgacgaggtggtgagactcgtgaccgcggacgac
gttccgaacgtcgagctcgtgtcagccgatgacctcgacgacgtgcgtgctgatgtcgtc
gagtggggtatggcccttcgaacggctgcccgcgacgccgatgccgaagccgctctcgat
gccctcgacacccatcgcgtgttgtgcgcgcaccgtgaagggtcgtcgggcgtccgcgga
tggtcggccaggatcaccgagtggctcggtaccgcaggcgcggagcacaccggatggtat
ccgggacagccgatcctggtcaccgccaatgatcgtcagacgtcgacgttcaacggtgac
accggtgtcgtgatcgccgaccccgacggccgaatgcagggagccgacgccgtccgggtc
gccttccggcggggcggatctgtccgactgctgcacccgacgcaactcgccgacgtggag
tcggtccacgcgatgacgatccaccgtagccaggggagtcagttccggcaggtcacggtg
atccttcctcccccggggtcggagttgctcacccgggagctgctctacaccgccatcact
cgagcccgcgagcgcgtgcggatcgtcgggacgccagaggtcctcgccgcggcggtcgat
cgacgcgtgcagcgggccagcggtctgcgatcagcggtgacacctttcggggatacggag
tga

DBGET integrated database retrieval system