KEGG   Gordonia sp. KTR9: KTR9_2643Help
Entry
KTR9_2643         CDS       T02216                                 

Definition
Malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
gor  Gordonia sp. KTR9
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:gor01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:gor00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:gor00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3020084..3022276
Genome map
AA seq 730 aa AA seqDB search
MSDRITVNGLQVATVLHDFINNEALPGSGVDADAFWAGAASVIADLAPRNRELLAVRDEL
QTKLDAWHRDHKDADLTPGTADFDEYTSYLTEIGYLAEVPADFQITTSNVDREIADTAGP
QLVVPILNARFALNASNARWGSLYDALYGTDAIPESDGAEKGSSYNKVRGDKVIAYAKDF
LDKAVPLEQCSYTDVRAFAVVDGALQVTLDGDKTSTLADPTAFVGYRGDAGSPTSILLRN
NGLHLDIEIDPSSPIGSTDPAGIKDVVVESAITTIMDFEDSVAAVDAEDKVIGYRNWLGL
NKGDLAEEVSKGGKTFTRVLNGDREYTAPDGTTFDLHGRSLLFVRNVGHLMTNDAILDAD
GNEVPEGILDGLITSLIGIHGMSDQGLQNSRSGSVYIVKPKMHGPDEVAFTVELFGRVEK
VLGLPENTLKVGIMDEERRTTVNLKACIKAAQERVVFINTGFLDRTGDEIHTSMEAGPMV
RKAEMKQQTWIGAYENFNVDTGLHAGLQHKAQIGKGMWAMPDLMADMLEQKIGHPKAGAT
TAWVPSPTAATLHALHYHLVDVFERQDEIAKRDPARVEDVLTIPLAPKTDWSDEEKQQEL
DNNCQSILGYVVRWIDQGVGCSKVPDIHDVALMEDRATLRISSQLLANWLRHGIVGESDI
VASLERMAPVVDRQNAGDPTYRPLAPDFDSNIAFQAAKELILEGTTQPSGYTEPILHRRR
REYKAANPAG
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaccggatcaccgtcaacgggttgcaggtcgccaccgtcctgcacgacttcatc
aacaacgaggcgttgcccggttccggtgtagatgcggatgccttctgggccggcgcggca
tcggtgatcgccgatctcgccccgcgcaaccgcgagctgctcgccgtccgcgacgaactg
cagaccaagctcgacgcctggcaccgtgaccacaaagacgccgatctcacccccggcacc
gccgacttcgacgagtacacctcgtacctcaccgaaatcggttacctcgccgaggtcccg
gccgacttccagatcaccacgtcgaacgtcgaccgcgagatcgccgacaccgcaggtccg
cagctcgtggtcccgatcctcaacgcgcgcttcgcgctcaacgcctcgaacgcacggtgg
ggctcgctctacgacgcgctctacggcaccgacgcgatccccgagtccgacggagccgag
aagggttcgtcctacaacaaggtccgcggcgacaaggtcatcgcctacgccaaggacttc
ctcgacaaagccgtgccgctcgaacagtgcagctacaccgacgtacgtgcgttcgcggtc
gtcgacggcgcactgcaggtgacgctcgacggcgacaagacctcgaccctcgccgatccg
accgcgttcgtcggataccggggcgatgccggctcgccgacctcgatcctgctgcgcaac
aacggactacacctcgacatcgagatcgatccgtcctcgcccatcggctccaccgacccg
gccggcatcaaggatgtcgtcgtcgagtccgccatcaccacgatcatggacttcgaggac
tcggtcgccgcggtcgacgccgaggacaaggtgatcggttaccgcaactggctgggcctc
aacaagggcgatctcgccgaagaggtctccaagggcggcaagaccttcacccgtgtgctc
aacggcgaccgcgagtacaccgccccggacggcaccacgttcgatctgcacggtcggtcg
ctgctcttcgtccgcaacgtcggacatctgatgaccaacgacgccatcctcgacgccgac
ggcaacgaggtccccgaaggcatcctcgacggcctgatcacctcgctgatcggcatccac
ggaatgagcgaccagggactgcagaactcgcggagcggttcggtctacatcgtgaagccg
aagatgcacggtcccgacgaggtcgccttcaccgtcgagctgttcggccgcgtggagaag
gtcctcggcctgccggagaacacactcaaggtcggcatcatggacgaggagcgccgcacg
accgtgaacctcaaggcgtgcatcaaggccgcccaggagcgcgtcgtgttcatcaacacc
ggcttcctcgaccgcaccggcgacgagatccacacctccatggaggccgggccgatggtc
cgcaaggccgagatgaagcagcagacctggatcggtgcgtacgagaacttcaacgtcgac
acgggcctgcacgccggcctgcagcacaaggcacagatcggcaagggcatgtgggccatg
cccgacctgatggccgacatgctcgagcagaagatcgggcatccgaaggccggcgccacc
accgcgtgggtgccgtcgccgacggccgcgacgctgcatgcgctgcactaccacctcgtc
gacgtcttcgagcgccaggacgagatcgccaagcgcgatcccgcccgggtcgaggacgtc
ctcaccatcccgctcgcgccgaagaccgactggtccgacgaggagaagcagcaggaactc
gacaacaactgccagtccatcctcggctacgtggtgcgctggatcgaccagggtgtcggc
tgttccaaggtgcccgacatccacgacgtcgcgctcatggaagaccgtgcgaccctgcgg
atctcgagccagctgctggcgaactggctgcgtcacggcatcgtcggcgagtccgacatc
gtggcctcgctcgagcggatggcccccgtggtcgaccgtcagaacgccggcgacccgacc
taccgtccgctggcgccggacttcgactccaacatcgccttccaggcggccaaggaactg
atcctcgagggcacgacgcagccgagcggctacaccgagccgatcctgcaccgacggcgc
cgcgagtacaaggcggccaacccggcgggctga

DBGET integrated database retrieval system