KEGG   Gordonia sp. KTR9: KTR9_2643Help
Entry
KTR9_2643         CDS       T02216                                 

Definition
(RefSeq) Malate synthase
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
gor  Gordonia sp. KTR9
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:gor00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KTR9_2643
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KTR9_2643
   00630 Glyoxylate and dicarboxylate metabolism
    KTR9_2643
Enzymes [BR:gor01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     KTR9_2643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3020084..3022276
Genome map
AA seq 730 aa AA seqDB search
MSDRITVNGLQVATVLHDFINNEALPGSGVDADAFWAGAASVIADLAPRNRELLAVRDEL
QTKLDAWHRDHKDADLTPGTADFDEYTSYLTEIGYLAEVPADFQITTSNVDREIADTAGP
QLVVPILNARFALNASNARWGSLYDALYGTDAIPESDGAEKGSSYNKVRGDKVIAYAKDF
LDKAVPLEQCSYTDVRAFAVVDGALQVTLDGDKTSTLADPTAFVGYRGDAGSPTSILLRN
NGLHLDIEIDPSSPIGSTDPAGIKDVVVESAITTIMDFEDSVAAVDAEDKVIGYRNWLGL
NKGDLAEEVSKGGKTFTRVLNGDREYTAPDGTTFDLHGRSLLFVRNVGHLMTNDAILDAD
GNEVPEGILDGLITSLIGIHGMSDQGLQNSRSGSVYIVKPKMHGPDEVAFTVELFGRVEK
VLGLPENTLKVGIMDEERRTTVNLKACIKAAQERVVFINTGFLDRTGDEIHTSMEAGPMV
RKAEMKQQTWIGAYENFNVDTGLHAGLQHKAQIGKGMWAMPDLMADMLEQKIGHPKAGAT
TAWVPSPTAATLHALHYHLVDVFERQDEIAKRDPARVEDVLTIPLAPKTDWSDEEKQQEL
DNNCQSILGYVVRWIDQGVGCSKVPDIHDVALMEDRATLRISSQLLANWLRHGIVGESDI
VASLERMAPVVDRQNAGDPTYRPLAPDFDSNIAFQAAKELILEGTTQPSGYTEPILHRRR
REYKAANPAG
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaccggatcaccgtcaacgggttgcaggtcgccaccgtcctgcacgacttcatc
aacaacgaggcgttgcccggttccggtgtagatgcggatgccttctgggccggcgcggca
tcggtgatcgccgatctcgccccgcgcaaccgcgagctgctcgccgtccgcgacgaactg
cagaccaagctcgacgcctggcaccgtgaccacaaagacgccgatctcacccccggcacc
gccgacttcgacgagtacacctcgtacctcaccgaaatcggttacctcgccgaggtcccg
gccgacttccagatcaccacgtcgaacgtcgaccgcgagatcgccgacaccgcaggtccg
cagctcgtggtcccgatcctcaacgcgcgcttcgcgctcaacgcctcgaacgcacggtgg
ggctcgctctacgacgcgctctacggcaccgacgcgatccccgagtccgacggagccgag
aagggttcgtcctacaacaaggtccgcggcgacaaggtcatcgcctacgccaaggacttc
ctcgacaaagccgtgccgctcgaacagtgcagctacaccgacgtacgtgcgttcgcggtc
gtcgacggcgcactgcaggtgacgctcgacggcgacaagacctcgaccctcgccgatccg
accgcgttcgtcggataccggggcgatgccggctcgccgacctcgatcctgctgcgcaac
aacggactacacctcgacatcgagatcgatccgtcctcgcccatcggctccaccgacccg
gccggcatcaaggatgtcgtcgtcgagtccgccatcaccacgatcatggacttcgaggac
tcggtcgccgcggtcgacgccgaggacaaggtgatcggttaccgcaactggctgggcctc
aacaagggcgatctcgccgaagaggtctccaagggcggcaagaccttcacccgtgtgctc
aacggcgaccgcgagtacaccgccccggacggcaccacgttcgatctgcacggtcggtcg
ctgctcttcgtccgcaacgtcggacatctgatgaccaacgacgccatcctcgacgccgac
ggcaacgaggtccccgaaggcatcctcgacggcctgatcacctcgctgatcggcatccac
ggaatgagcgaccagggactgcagaactcgcggagcggttcggtctacatcgtgaagccg
aagatgcacggtcccgacgaggtcgccttcaccgtcgagctgttcggccgcgtggagaag
gtcctcggcctgccggagaacacactcaaggtcggcatcatggacgaggagcgccgcacg
accgtgaacctcaaggcgtgcatcaaggccgcccaggagcgcgtcgtgttcatcaacacc
ggcttcctcgaccgcaccggcgacgagatccacacctccatggaggccgggccgatggtc
cgcaaggccgagatgaagcagcagacctggatcggtgcgtacgagaacttcaacgtcgac
acgggcctgcacgccggcctgcagcacaaggcacagatcggcaagggcatgtgggccatg
cccgacctgatggccgacatgctcgagcagaagatcgggcatccgaaggccggcgccacc
accgcgtgggtgccgtcgccgacggccgcgacgctgcatgcgctgcactaccacctcgtc
gacgtcttcgagcgccaggacgagatcgccaagcgcgatcccgcccgggtcgaggacgtc
ctcaccatcccgctcgcgccgaagaccgactggtccgacgaggagaagcagcaggaactc
gacaacaactgccagtccatcctcggctacgtggtgcgctggatcgaccagggtgtcggc
tgttccaaggtgcccgacatccacgacgtcgcgctcatggaagaccgtgcgaccctgcgg
atctcgagccagctgctggcgaactggctgcgtcacggcatcgtcggcgagtccgacatc
gtggcctcgctcgagcggatggcccccgtggtcgaccgtcagaacgccggcgacccgacc
taccgtccgctggcgccggacttcgactccaacatcgccttccaggcggccaaggaactg
atcctcgagggcacgacgcagccgagcggctacaccgagccgatcctgcaccgacggcgc
cgcgagtacaaggcggccaacccggcgggctga

DBGET integrated database retrieval system